DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRSF2 and srsf2a

DIOPT Version :9

Sequence 1:NP_001182356.1 Gene:SRSF2 / 6427 HGNCID:10783 Length:221 Species:Homo sapiens
Sequence 2:NP_998547.1 Gene:srsf2a / 406691 ZFINID:ZDB-GENE-040426-2706 Length:225 Species:Danio rerio


Alignment Length:227 Identity:187/227 - (82%)
Similarity:203/227 - (89%) Gaps:8/227 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDK 65
            |||||||||||||||||||||||||||:|||||||||||||||||||||||||||||||||||||
Zfish     1 MSYGRPPPDVEGMTSLKVDNLTYRTSPETLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDK 65

Human    66 RDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRYGGGGYGRRSRSPRRRR--RS 128
            |||||||||||||:||||||||||||||||||:|:||||.|||||||.|...||||||||:  ||
Zfish    66 RDAEDAMDAMDGALLDGRELRVQMARYGRPPDAHYSRRGAPPRRYGGYGRRSRSRSPRRRKHSRS 130

Human   129 RSRSRSRSRSRSRSRYSRSKSR--SRTRSRSRSTSKSRSARRSKSKSSSVSRSRSRSRSRSRSRS 191
            |||||||||||||||||||:||  ||:||||||.||:|:.|||||||.|.|||||:|:|.||||:
Zfish   131 RSRSRSRSRSRSRSRYSRSRSRSYSRSRSRSRSRSKTRTPRRSKSKSPSRSRSRSKSKSHSRSRT 195

Human   192 PPPVSKRESKSRSRSKSPPKSPE--EEGAVSS 221
            |.  |.:.|||||||:|.|||||  ::.||.|
Zfish   196 PR--SNKGSKSRSRSRSRPKSPEATDDAAVES 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRSF2NP_001182356.1 RRM_SRSF2_SRSF8 16..88 CDD:409751 69/71 (97%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..221 97/134 (72%)
srsf2aNP_998547.1 RRM <5..>91 CDD:223796 83/85 (98%)
RRM_SRSF2_SRSF8 16..88 CDD:240757 69/71 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C194335003
Domainoid 1 1.000 144 1.000 Domainoid score I18636
eggNOG 1 0.900 - - E1_KOG4207
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 352 1.000 Inparanoid score I8672
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51897
OrthoDB 1 1.010 - - D1524134at2759
OrthoFinder 1 1.000 - - FOG0003650
OrthoInspector 1 1.000 - - otm28508
orthoMCL 1 0.900 - - OOG6_104633
Panther 1 1.100 - - LDO PTHR23147
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1169
SonicParanoid 1 1.000 - - X3014
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 1 1.500 - -
1616.300

Return to query results.
Submit another query.