DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCX and CG33557

DIOPT Version :9

Sequence 1:NP_001073983.1 Gene:SCX / 642658 HGNCID:32322 Length:201 Species:Homo sapiens
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:171 Identity:64/171 - (37%)
Similarity:84/171 - (49%) Gaps:46/171 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    23 SEDEDRGSDSSGS----DEKPCRVHAARCGLQGARRRAGGRRAGGGG---PGGRPGREPRQRHTA 80
            ::|.:....:|||    |.:..::               |:.|..||   .|....|.|||:  .
  Fly    19 AQDSNSSGSASGSGAAADSEDSQI---------------GQEANPGGQENQGNHRRRPPRQK--I 66

Human    81 NARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVLLAGEACGDGQPCHS 145
            |||||.||.:||:|:.|||.||||||.:|||||||.:|||||||:||.:.|..|..|   |||  
  Fly    67 NARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLETGTEC---QPC-- 126

Human   146 GPAFFHAARAGSPPPPPPPPPARDGENTQPKQICTFCLSNQ 186
               ..|...:             :| .|:...||||||..:
  Fly   127 ---LLHKYES-------------EG-ITRRISICTFCLKTK 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCXNP_001073983.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92 21/75 (28%)
bHLH_TS_scleraxis 73..140 CDD:381521 41/66 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 148..177 3/28 (11%)
CG33557NP_001014730.1 HLH 67..119 CDD:197674 36/51 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149591
Domainoid 1 1.000 74 1.000 Domainoid score I9147
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5122
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000894
OrthoInspector 1 1.000 - - otm40367
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5068
SonicParanoid 1 1.000 - - X1534
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.920

Return to query results.
Submit another query.