Sequence 1: | NP_001073983.1 | Gene: | SCX / 642658 | HGNCID: | 32322 | Length: | 201 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262334.1 | Gene: | Fer1 / 2768661 | FlyBaseID: | FBgn0037475 | Length: | 256 | Species: | Drosophila melanogaster |
Alignment Length: | 223 | Identity: | 61/223 - (27%) |
---|---|---|---|
Similarity: | 83/223 - (37%) | Gaps: | 84/223 - (37%) |
- Green bases have known domain annotations that are detailed below.
Human 18 EVSPLSEDEDR------GSDSSGSDEKPC----RVHAAR---CGLQGARRRAGGRRAGGGGPGGR 69
Human 70 PGREPRQRHTANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVL--- 131
Human 132 ----------------------------------LAGEACGDGQPCHSGPAFFHAARAGSPPPPP 162
Human 163 PPPPARDGENTQPKQICTFCLSNQRKLS 190 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
SCX | NP_001073983.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..92 | 24/86 (28%) | |
bHLH_TS_scleraxis | 73..140 | CDD:381521 | 32/103 (31%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 148..177 | 7/28 (25%) | |||
Fer1 | NP_001262334.1 | HLH | 92..144 | CDD:197674 | 27/51 (53%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4029 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |