DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCX and Fer1

DIOPT Version :9

Sequence 1:NP_001073983.1 Gene:SCX / 642658 HGNCID:32322 Length:201 Species:Homo sapiens
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:223 Identity:61/223 - (27%)
Similarity:83/223 - (37%) Gaps:84/223 - (37%)


- Green bases have known domain annotations that are detailed below.


Human    18 EVSPLSEDEDR------GSDSSGSDEKPC----RVHAAR---CGLQGARRRAGGRRAGGGGPGGR 69
            |.|..|:|||.      .||...:::..|    |.|..|   |..|.|                 
  Fly    38 EHSSESDDEDDAYSSGFNSDQENTEKTFCPFSRRSHKPRRLKCASQMA----------------- 85

Human    70 PGREPRQRHTANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVL--- 131
                 :||..||.|||.|..|:|.||..|||.|||.|.:::|||::||:||.|||:.|..::   
  Fly    86 -----QQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKD 145

Human   132 ----------------------------------LAGEACGDGQPCHSGPAFFHAARAGSPPPPP 162
                                              |:....||..|   |...:  ||..:|..| 
  Fly   146 KNGNEPGLSLQRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYP---GSKLY--ARTWTPEDP- 204

Human   163 PPPPARDGENTQPKQICTFCLSNQRKLS 190
                  .|.::||..:.....|||.:.|
  Fly   205 ------RGPHSQPLPLYNNSNSNQNQNS 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCXNP_001073983.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92 24/86 (28%)
bHLH_TS_scleraxis 73..140 CDD:381521 32/103 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 148..177 7/28 (25%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.