DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRSF1 and CstF64

DIOPT Version :10

Sequence 1:NP_008855.1 Gene:SRSF1 / 6426 HGNCID:10780 Length:248 Species:Homo sapiens
Sequence 2:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster


Alignment Length:73 Identity:22/73 - (30%)
Similarity:41/73 - (56%) Gaps:3/73 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    18 IYVGNLPPDIRTKDIEDVFYKYGAIRDIDLK-NRRGGPP--FAFVEFEDPRDAEDAVYGRDGYDY 79
            ::|||:|.:...:.::::|.:.|.:..:.|. :|..|.|  |.|.|::|...|..|:...:||:.
  Fly    18 VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYEI 82

Human    80 DGYRLRVE 87
            .|..|||:
  Fly    83 GGRTLRVD 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRSF1NP_008855.1 RRM1_SRSF1 12..90 CDD:410010 22/73 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..134 22/73 (30%)
RRM2_SRSF1 113..196 CDD:410160
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..248
Interaction with SAFB1 198..247
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 22/73 (30%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.