DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRSF1 and B52

DIOPT Version :9

Sequence 1:NP_008855.1 Gene:SRSF1 / 6426 HGNCID:10780 Length:248 Species:Homo sapiens
Sequence 2:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster


Alignment Length:265 Identity:120/265 - (45%)
Similarity:147/265 - (55%) Gaps:42/265 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    17 RIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDG 81
            |:|||.||..:|.:|:|..|..||..|||.:||..|     ||||||.|||:||||..:|.:..|
  Fly     5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYG-----FVEFEDYRDADDAVYELNGKELLG 64

Human    82 YRLRVEFPR-SGRGTGR-------GGGGGGGGG---------APRGRYGPPSRRSENRVVVSGLP 129
            .|:.||..| :.||:.|       ||..|||||         ....||||| .|:|.|::|..|.
  Fly    65 ERVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPP-LRTEYRLIVENLS 128

Human   130 PSGSWQDLKDHMREAGDVCYADVY--RDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRV 192
            ...|||||||:||:||:|.|||.:  |...|||||....||..|:.|||:|:.   .|...::..
  Fly   129 SRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTEL---NGRRIHLVE 190

Human   193 KVDGPRS------------PSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRG--SPRYSPRHSR 243
            ...|.||            .|..|||||||.|||||..|:|||:|.|..:|||  |...||..||
  Fly   191 DRRGGRSGGGGGSGRGRSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSR 255

Human   244 SRSRT 248
            ||||:
  Fly   256 SRSRS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRSF1NP_008855.1 RRM1_SRSF1 12..90 CDD:410010 36/72 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..134 21/62 (34%)
RRM2_SRSF1 113..196 CDD:410160 37/84 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..248 33/70 (47%)
Interaction with SAFB1 198..247 31/62 (50%)
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 36/73 (49%)
RRM2_SRSF4_like 120..191 CDD:241044 32/73 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1390
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.