DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRSF1 and Rbp1

DIOPT Version :10

Sequence 1:NP_008855.1 Gene:SRSF1 / 6426 HGNCID:10780 Length:248 Species:Homo sapiens
Sequence 2:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster


Alignment Length:113 Identity:51/113 - (45%)
Similarity:62/113 - (54%) Gaps:5/113 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    16 CRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYD 80
            |::|||||.......:||..|.|||.:|::.:  .|..|.||||||||.||||||....||....
  Fly    11 CKVYVGNLGSSASKHEIEGAFAKYGPLRNVWV--ARNPPGFAFVEFEDRRDAEDATRALDGTRCC 73

Human    81 GYRLRVEFPRSGRGTG-RGGGGGGGGGAPRGRYG-PPSRRSENRVVVS 126
            |.|:|||. .|||... |.|.||..|.:..|||. .||.|:.:....|
  Fly    74 GTRIRVEM-SSGRSRDRRRGEGGSSGRSGSGRYRITPSARTTSTATSS 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRSF1NP_008855.1 RRM1_SRSF1 12..90 CDD:410010 36/73 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..134 15/41 (37%)
RRM2_SRSF1 113..196 CDD:410160 4/15 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..248
Interaction with SAFB1 198..247
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 34/70 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.