DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRSF1 and Rbp1-like

DIOPT Version :10

Sequence 1:NP_008855.1 Gene:SRSF1 / 6426 HGNCID:10780 Length:248 Species:Homo sapiens
Sequence 2:NP_001188585.1 Gene:Rbp1-like / 32293 FlyBaseID:FBgn0030479 Length:247 Species:Drosophila melanogaster


Alignment Length:108 Identity:54/108 - (50%)
Similarity:64/108 - (59%) Gaps:6/108 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    16 CRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYD 80
            |::|||||.......:||:.|.|||.:|::.:  .|..|.||||||||.||||||..|.||....
  Fly    11 CKVYVGNLGSSASKYEIENAFSKYGPLRNVWV--ARNPPGFAFVEFEDRRDAEDATRGLDGTRCC 73

Human    81 GYRLRVEF----PRSGRGTGRGGGGGGGGGAPRGRYGPPSRRS 119
            |.|:|||.    .|.|||.|.||||||||....||.|....|:
  Fly    74 GTRIRVEMSSGRSREGRGGGGGGGGGGGGSGGGGRGGGSGARA 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRSF1NP_008855.1 RRM1_SRSF1 12..90 CDD:410010 37/77 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..134 17/36 (47%)
RRM2_SRSF1 113..196 CDD:410160 2/7 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..248
Interaction with SAFB1 198..247
Rbp1-likeNP_001188585.1 RRM_SRSF3_like 12..81 CDD:409808 35/70 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.