DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SFRP5 and fz

DIOPT Version :9

Sequence 1:NP_003006.2 Gene:SFRP5 / 6425 HGNCID:10779 Length:317 Species:Homo sapiens
Sequence 2:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster


Alignment Length:229 Identity:72/229 - (31%)
Similarity:101/229 - (44%) Gaps:40/229 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     6 AGGGVRTAALALLLGALHWAPARCEEYDYYGWQAEPLHGRSYSKPPQCLDIPADLPLCHTVGYKR 70
            :|||:..::...|.|..|  ..|||                          |..:.:|..:.|..
  Fly    32 SGGGLMASSGTELDGLPH--HNRCE--------------------------PITISICKNIPYNM 68

Human    71 MRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVC--LDRPIYPCRSLCEAVRA 133
            ..:|||:.|....|...:...:.||:...|..|.|:|||||:.|||  |:|||.|||||||:.|.
  Fly    69 TIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTILERPIPPCRSLCESARV 133

Human   134 GCAPLMEAYGFPWPEMLHCHKFPL--DNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQ 196
             |..||:.|.|.|||.|.|.|||:  ..|||:|.......:||...|:..|:........|:...
  Fly   134 -CEKLMKTYNFNWPENLECSKFPVHGGEDLCVAENTTSSASTAATPTRSVAKVTTRKHQTGVESP 197

Human   197 MCSSDFVVKMRIK-------EIKIENGDRKLIGA 223
            ..:..||..:::|       |:|:...|....||
  Fly   198 HRNIGFVCPVQLKTPLGMGYELKVGGKDLHDCGA 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SFRP5NP_003006.2 CRD_SFRP5 47..173 CDD:143553 50/129 (39%)
NTR_Sfrp1_like 178..303 CDD:239635 11/53 (21%)
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 53/142 (37%)
Frizzled 237..564 CDD:279827
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.