DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SFRP4 and fz

DIOPT Version :9

Sequence 1:NP_003005.2 Gene:SFRP4 / 6424 HGNCID:10778 Length:346 Species:Homo sapiens
Sequence 2:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster


Alignment Length:123 Identity:54/123 - (43%)
Similarity:81/123 - (65%) Gaps:8/123 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    21 GAP----CEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSAVLRFFLCAMY 81
            |.|    ||.:.|.:|:::|:|:|.|||.:.|:.||.|.|.:.|:..||.:.||..|:.|||::|
  Fly    46 GLPHHNRCEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLY 110

Human    82 APICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVY-DRGVCIS 138
            .|:||:  |..||.||:|:|:.|| .||.|||.||.:|||:|.|.:.||: ...:|::
  Fly   111 VPVCTI--LERPIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFPVHGGEDLCVA 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SFRP4NP_003005.2 CRD_FZ 20..146 CDD:321937 54/123 (44%)
NTR_like 188..296 CDD:321963
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..346
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 52/118 (44%)
Frizzled 237..564 CDD:279827
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.