Sequence 1: | NP_003005.2 | Gene: | SFRP4 / 6424 | HGNCID: | 10778 | Length: | 346 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_610297.2 | Gene: | Corin / 35691 | FlyBaseID: | FBgn0033192 | Length: | 1397 | Species: | Drosophila melanogaster |
Alignment Length: | 197 | Identity: | 50/197 - (25%) |
---|---|---|---|
Similarity: | 75/197 - (38%) | Gaps: | 45/197 - (22%) |
- Green bases have known domain annotations that are detailed below.
Human 16 ALGVRGAP--CEAVRIPMCR--HMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSAVLRFF 76
Human 77 LCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEA 141
Human 142 IVTDLP--EDVKWIDITPDMM-------------------VQERPLD--VDCKRLSPDRCKCKKV 183
Human 184 KP 185 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
SFRP4 | NP_003005.2 | CRD_FZ | 20..146 | CDD:321937 | 34/129 (26%) |
NTR_like | 188..296 | CDD:321963 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 292..346 | ||||
Corin | NP_610297.2 | CRD_FZ | 778..894 | CDD:143549 | 36/132 (27%) |
LDLa | 911..942 | CDD:238060 | 6/31 (19%) | ||
LDLa | 945..979 | CDD:238060 | 1/3 (33%) | ||
SR | 980..>1034 | CDD:214555 | |||
SRCR | 992..1086 | CDD:278931 | |||
Tryp_SPc | 1103..1343 | CDD:214473 | |||
Tryp_SPc | 1104..1346 | CDD:238113 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |