DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SFRP4 and Corin

DIOPT Version :9

Sequence 1:NP_003005.2 Gene:SFRP4 / 6424 HGNCID:10778 Length:346 Species:Homo sapiens
Sequence 2:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster


Alignment Length:197 Identity:50/197 - (25%)
Similarity:75/197 - (38%) Gaps:45/197 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    16 ALGVRGAP--CEAVRIPMCR--HMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSAVLRFF 76
            :.|...||  |..:.:..|:  .:|:|.|..||::.|..|......::.||.||||.|..::..|
  Fly   769 SFGKNPAPGTCLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLF 833

Human    77 LCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEA 141
            ||.::.|.|.......|  |||::|......|.....::..|.||.|.|               .
  Fly   834 LCTLFVPKCGQSGATVP--PCKTLCTETMRRCGFFFDVFGLSLPEYLNC---------------K 881

Human   142 IVTDLP--EDVKWIDITPDMM-------------------VQERPLD--VDCKRLSPDRCKCKKV 183
            :..|.|  ||...:|...::|                   .||...|  :||.. ..|..||::.
  Fly   882 LFKDFPSSEDCVGLDEVREVMRAATHPKCDGFQCDQNRCLPQEYVCDGHLDCMD-QADEAKCERC 945

Human   184 KP 185
            .|
  Fly   946 GP 947

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SFRP4NP_003005.2 CRD_FZ 20..146 CDD:321937 34/129 (26%)
NTR_like 188..296 CDD:321963
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..346
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 36/132 (27%)
LDLa 911..942 CDD:238060 6/31 (19%)
LDLa 945..979 CDD:238060 1/3 (33%)
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.