DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SFRP2 and fz2

DIOPT Version :9

Sequence 1:NP_003004.1 Gene:SFRP2 / 6423 HGNCID:10777 Length:295 Species:Homo sapiens
Sequence 2:NP_001262037.1 Gene:fz2 / 40090 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster


Alignment Length:139 Identity:49/139 - (35%)
Similarity:69/139 - (49%) Gaps:20/139 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    40 CKPIPANLQLCHGIEYQNMRLPNLLGHETMKEV-LEQAGAWIPLVMKQCHPDTKKFLCSLFAPVC 103
            |:.|  .:.:|.||.|.....||.:.|||..|. ||....| |||..:|.||.|.||||::.|:|
  Fly    64 CEEI--TIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFW-PLVEIKCSPDLKFFLCSMYTPIC 125

Human   104 LDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDND---LCIPLASSDHLLPAT 165
            |:|..:.:..|.|:|.:.:..|||:|..:.|.||:.:.|:..|...|   ||:            
  Fly   126 LEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCM------------ 178

Human   166 EEAPKVCEA 174
             |.|...||
  Fly   179 -EQPSYTEA 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SFRP2NP_003004.1 CRD_SFRP2 36..163 CDD:143555 45/126 (36%)
NTR_Sfrp1_like 169..295 CDD:239635 3/6 (50%)
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 46/133 (35%)
Frizzled 308..618 CDD:279827
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.