DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SFRP2 and Corin

DIOPT Version :9

Sequence 1:NP_003004.1 Gene:SFRP2 / 6423 HGNCID:10777 Length:295 Species:Homo sapiens
Sequence 2:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster


Alignment Length:169 Identity:44/169 - (26%)
Similarity:62/169 - (36%) Gaps:39/169 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    43 IPANLQLCHG--IEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLD 105
            :|..::.|.|  |.|.....||.:||....|......::..||..:|:.....|||:||.|.| .
  Fly   780 LPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFLCTLFVPKC-G 843

Human   106 DLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDML------------------------------ 140
            ....|:.||.:||.:...||......||...|:.|                              
  Fly   844 QSGATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFKDFPSSEDCVGLDEVREVMRAATHP 908

Human   141 ECDRFPQDNDLCIP--LASSDHL--LPATEEAPKVCEAC 175
            :||.|..|.:.|:|  .....||  :...:||.  ||.|
  Fly   909 KCDGFQCDQNRCLPQEYVCDGHLDCMDQADEAK--CERC 945

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SFRP2NP_003004.1 CRD_SFRP2 36..163 CDD:143555 39/155 (25%)
NTR_Sfrp1_like 169..295 CDD:239635 3/7 (43%)
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 31/114 (27%)
LDLa 911..942 CDD:238060 9/32 (28%)
LDLa 945..979 CDD:238060 1/1 (100%)
SR 980..>1034 CDD:214555
SRCR 992..1086 CDD:278931
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.