DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SFRP1 and smo

DIOPT Version :9

Sequence 1:NP_003003.3 Gene:SFRP1 / 6422 HGNCID:10776 Length:314 Species:Homo sapiens
Sequence 2:NP_523443.1 Gene:smo / 33196 FlyBaseID:FBgn0003444 Length:1036 Species:Drosophila melanogaster


Alignment Length:128 Identity:29/128 - (22%)
Similarity:49/128 - (38%) Gaps:23/128 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    80 NLLEHETMAEVKQQASSWVPLLN-KNCHAGTQVFLCSLFAPVC-----LDRPIYPCRWLCEAVRD 138
            :|.:..|..|:..:.:.:..|.: ..|.|..|.|||::|.|.|     .|....|...:|....:
  Fly   113 DLTDFHTEKELNDKLNDYYALKHVPKCWAAIQPFLCAVFKPKCEKINGEDMVYLPSYEMCRITME 177

Human   139 SCEPVMQFFGFYWPEMLKCD---------------KFPEGDVCIAMTPPNATEASKPQGTTVC 186
            .|.  :.:...::|:.|:|:               ||.....|::...|..|.||...|...|
  Fly   178 PCR--ILYNTTFFPKFLRCNETLFPTKCTNGARGMKFNGTGQCLSP
LVPTDTSASYYPGIEGC 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SFRP1NP_003003.3 CRD_SFRP1 52..175 CDD:143552 24/115 (21%)
NTR_Sfrp1_like 183..306 CDD:239635 1/4 (25%)
smoNP_523443.1 CRD_SMO 86..221 CDD:143560 23/109 (21%)
Frizzled 246..568 CDD:279827
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.