DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SFPQ and x16

DIOPT Version :9

Sequence 1:NP_005057.1 Gene:SFPQ / 6421 HGNCID:10774 Length:707 Species:Homo sapiens
Sequence 2:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster


Alignment Length:90 Identity:26/90 - (28%)
Similarity:45/90 - (50%) Gaps:7/90 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   286 RRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKG-KGFGFIKLESRALAEIAK 349
            |.|.::      :::||:|..:..:::.:.:|..||....|:|.:. .||.|::.||...|..|.
  Fly     3 RHPSDR------KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAV 61

Human   350 AELDDTPMRGRQLRVRFATHAAALS 374
            ..||...:.||:.||..:|...|.|
  Fly    62 RGLDGRTVCGRRARVELSTGKYARS 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SFPQNP_005057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..273
3 X 3 AA repeats of R-G-G 9..27
RRM1_PSF 296..366 CDD:241031 21/70 (30%)
RRM2_p54nrb_like 372..451 CDD:240779 2/3 (67%)
NOPS_PSF 442..538 CDD:240583
PTZ00121 <499..>599 CDD:173412
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 579..707
x16NP_723226.1 RRM <1..>82 CDD:223796 24/84 (29%)
RRM_SRSF3_like 9..81 CDD:240819 21/71 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.