DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAP2K4 and Mkk4

DIOPT Version :9

Sequence 1:NP_001268364.1 Gene:MAP2K4 / 6416 HGNCID:6844 Length:410 Species:Homo sapiens
Sequence 2:NP_001163551.1 Gene:Mkk4 / 41020 FlyBaseID:FBgn0024326 Length:424 Species:Drosophila melanogaster


Alignment Length:404 Identity:233/404 - (57%)
Similarity:277/404 - (68%) Gaps:36/404 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     4 PSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGFQINFCEKAQSKRKALKLNFANPPFKSTA 68
            |..|....|.|.:.||:.             ||.|...:..|..||..::       .||..|: 
  Fly    33 PPSSTSSTSSGSTSSGSS-------------SSSQHNHVTRCFGAQQPQQ-------TPPVASS- 76

Human    69 RFTLNPNP----TGVQNPHIERLRTHSIESSGKLKI---SPEQHWDFTAEDLKDLGEIGRGAYGS 126
              .:.|.|    :...:.|.||:|.   ::.|||:.   ....| .||::||:|.|||||||:|:
  Fly    77 --QVPPVPAASSSSAADRHRERIRQ---QACGKLQFGEGGANTH-TFTSDDLEDEGEIGRGAFGA 135

Human   127 VNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMEL 191
            ||||..|...::||||||||||||||||||||||:|||:|::|.||||||||||:||||||||||
  Fly   136 VNKMTFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIYIVQFYGALFKEGDCWICMEL 200

Human   192 MSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGNIKL 256
            |.||.||||||:|......|||.||.|||:|||.|||:|||.|||||||:|||||||.|.|:|||
  Fly   201 MDTSLDKFYKYIYEKQQRHIPESILAKITVATVNALNYLKEELKIIHRDVKPSNILLHRRGDIKL 265

Human   257 CDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKW 321
            ||||||||||||||||:|||||||||||||||..:: |||||||||||||||.|:|||.|||.||
  Fly   266 CDFGISGQLVDSIAKTKDAGCRPYMAPERIDPERAK-GYDVRSDVWSLGITLMEVATGNFPYRKW 329

Human   322 NSVFDQLTQVVKGDPPQLSNS-EEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERA 385
            :|||:||.|||:|:||:|..| ...|||..|::|||.||.|.||.||||..||:.|||...|...
  Fly   330 DSVFEQLCQVVQGEPPRLLTSYNGMEFSKEFVDFVNTCLIKKESDRPKYSRLLEMPFIRRGETSH 394

Human   386 VEVACYVCKILDQM 399
            .:||.||..||:.|
  Fly   395 TDVAVYVADILESM 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAP2K4NP_001268364.1 PKc_MKK4 106..396 CDD:270790 205/290 (71%)
Mkk4NP_001163551.1 PKc_MKK4 115..405 CDD:270790 206/291 (71%)
S_TKc 123..387 CDD:214567 194/264 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159198
Domainoid 1 1.000 395 1.000 Domainoid score I763
eggNOG 1 0.900 - - E1_KOG1006
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H48159
Inparanoid 1 1.050 419 1.000 Inparanoid score I1809
Isobase 1 0.950 - 0 Normalized mean entropy S1132
OMA 1 1.010 - - QHG51923
OrthoDB 1 1.010 - - D470057at33208
OrthoFinder 1 1.000 - - FOG0001217
OrthoInspector 1 1.000 - - oto88817
orthoMCL 1 0.900 - - OOG6_101822
Panther 1 1.100 - - O PTHR48013
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2221
SonicParanoid 1 1.000 - - X3433
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.