DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAP2K4 and lic

DIOPT Version :9

Sequence 1:NP_001268364.1 Gene:MAP2K4 / 6416 HGNCID:6844 Length:410 Species:Homo sapiens
Sequence 2:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster


Alignment Length:336 Identity:173/336 - (51%)
Similarity:239/336 - (71%) Gaps:13/336 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    70 FTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKP 134
            ||:...|.....|      ..:::|...::|. ::.:|..|:.|:.:.::||||||.|:||.||.
  Fly    10 FTIAKEPEAAIVP------PRNLDSRATIQIG-DRTFDIDADSLEKICDLGRGAYGIVDKMRHKQ 67

Human   135 SGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKF 199
            :..::|||||..||:.:||.:|:||||:.||||||||.|.||||::||||.|||||:||||.|||
  Fly    68 TDTVLAVKRIPMTVNIREQHRLVMDLDISMRSSDCPYTVHFYGAMYREGDVWICMEVMSTSLDKF 132

Human   200 YKYVYSVLDDV-IPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGNIKLCDFGISG 263
            |..|:  |.|: :.|.:||||.::.|.||::|...||:||||:||||||::|:|.:|:|||||||
  Fly   133 YPKVF--LHDLRMEESVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNILINRAGQVKICDFGISG 195

Human   264 QLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQL 328
            .||||||||.||||:||||||||||..:...||:|||||||||.:.|:||||:||..|.:.|:||
  Fly   196 YLVDSIAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDVWSLGIGMIEMATGRYPYDNWRTPFEQL 260

Human   329 TQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVC 393
            .|||:..||:|   .|..|||.|.:|:.:||.|:...||.|::||||.||:.:.:|..:::.:|.
  Fly   261 RQVVEDSPPRL---PEGTFSPEFEDFIAVCLQKEYMARPNYEQLLKHSFIVEHLQRNTDISEFVA 322

Human   394 KILDQMPATPS 404
            :|||...|.|:
  Fly   323 RILDLPDAQPA 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAP2K4NP_001268364.1 PKc_MKK4 106..396 CDD:270790 162/290 (56%)
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 161/286 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51923
OrthoDB 1 1.010 - - D470057at33208
OrthoFinder 1 1.000 - - FOG0001217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101822
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2221
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.