DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAP2K4 and hep

DIOPT Version :9

Sequence 1:NP_001268364.1 Gene:MAP2K4 / 6416 HGNCID:6844 Length:410 Species:Homo sapiens
Sequence 2:NP_001368982.1 Gene:hep / 32256 FlyBaseID:FBgn0010303 Length:1294 Species:Drosophila melanogaster


Alignment Length:429 Identity:194/429 - (45%)
Similarity:244/429 - (56%) Gaps:48/429 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     2 AAPSPSGGGGSGGGSG---SGTPGPVGSPAP-----GHPAVSSMQGFQINFCEKAQSKRKALKLN 58
            |..:||.|.||..|||   :..|.|   |.|     |..:.||.......|...|.:..     .
  Fly    62 ATHAPSLGAGSVSGSGISIAQRPAP---PVPHATPFGSASASSSSSSASAFASAAPATG-----T 118

Human    59 FA---NPPFKSTARFT-----LNPNPTGVQN------------PHIERLRTHS-----IESSGKL 98
            |.   .||....:|.|     |:..|.|..|            ||.....|..     :|.:|||
  Fly   119 FGGTYTPPTTRVSRATPTLPMLSSGPGGGLNRTRPVILPLPTPPHPPVSETDMKLKIIMEQTGKL 183

Human    99 KISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVV 163
            .|:..| :.....|||.||::|.|..|:|.||:|..|..|:|||::|.|.:.:|.|::|||||||
  Fly   184 NINGRQ-YPTDINDLKHLGDLGNGTSGNVVKMMHLSSNTIIAVKQMRRTGNAEENKRILMDLDVV 247

Human   164 MRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALN 228
            ::|.||.|||:..|...|:.|.||||||||..|||..|    :....:||:||||:|:|||.||:
  Fly   248 LKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKLLK----LSKKPVPEQILGKVTVATVNALS 308

Human   229 HLKENLKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQ 293
            :||:...:||||:||||||:|..||||||||||||:||||.|.||.|||..|||||||||...: 
  Fly   309 YLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDSKANTRSAGCAAYMAPERIDPKKPK- 372

Human   294 GYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLC 358
             ||:|:|||||||||.||||.|.||...|:.|:.||:|:..:||.|...|...||..|.:||..|
  Fly   373 -YDIRADVWSLGITLVELATARSPYEGCNTDFEVLTKVLDSEPPCLPYGEGYNFSQQFRDFVIKC 436

Human   359 LTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILD 397
            |||:...||||.|||..|||.:||...|:|..:...|.|
  Fly   437 LTKNHQDRPKYPELLAQPFIRIYESAKVDVPNWFQSIKD 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAP2K4NP_001268364.1 PKc_MKK4 106..396 CDD:270790 156/289 (54%)
hepNP_001368982.1 PKc_MKK7 181..476 CDD:270791 163/302 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D470057at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.