| Sequence 1: | NP_001138914.1 | Gene: | POTEM / 641455 | HGNCID: | 37096 | Length: | 508 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001017750.1 | Gene: | acta1a / 550445 | ZFINID: | ZDB-GENE-050417-267 | Length: | 377 | Species: | Danio rerio |
| Alignment Length: | 218 | Identity: | 46/218 - (21%) |
|---|---|---|---|
| Similarity: | 78/218 - (35%) | Gaps: | 51/218 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Human 226 LEHGTDPNIPDEYGNTALHYAIYNEDKLMAK--ALLLYGADIESK-NKHGLTPLLLGVHEQKQQV 287
Human 288 VKFLIKKKANLNALDRYGRTV-LILAVCCGSASIVSLL-------LEQNIDVSSQDLSG------ 338
Human 339 --------QTAREYAVSSRHNVICQLLSDYKEKQILKVSSENSNPEQDLKLTSEEESQRLK---- 391
Human 392 ---GSENSQ-PEEMSQEPEINKG 410 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| POTEM | NP_001138914.1 | Ank_4 | 143..193 | CDD:290365 | |
| ANK | 167..292 | CDD:238125 | 16/68 (24%) | ||
| ANK 1 | 172..201 | ||||
| ANK repeat | 174..203 | CDD:293786 | |||
| Ank_2 | 177..269 | CDD:289560 | 13/45 (29%) | ||
| ANK repeat | 205..236 | CDD:293786 | 4/9 (44%) | ||
| ANK 2 | 205..234 | 3/7 (43%) | |||
| ANK | 233..357 | CDD:238125 | 29/148 (20%) | ||
| ANK repeat | 238..269 | CDD:293786 | 8/33 (24%) | ||
| ANK 3 | 238..267 | 7/30 (23%) | |||
| Ank_2 | 243..335 | CDD:289560 | 21/102 (21%) | ||
| ANK repeat | 271..302 | CDD:293786 | 4/30 (13%) | ||
| ANK 4 | 271..300 | 4/28 (14%) | |||
| ANK repeat | 304..335 | CDD:293786 | 7/38 (18%) | ||
| ANK 5 | 304..333 | 7/36 (19%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 369..487 | 13/50 (26%) | |||
| acta1a | NP_001017750.1 | NBD_sugar-kinase_HSP70_actin | 4..377 | CDD:302596 | 46/218 (21%) |
| ACTIN | 7..377 | CDD:214592 | 46/218 (21%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5277 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| NCBI | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 1 | 0.900 | - | - | OOG6_100127 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.710 | |||||