DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POTEM and Act88F

DIOPT Version :9

Sequence 1:NP_001138914.1 Gene:POTEM / 641455 HGNCID:37096 Length:508 Species:Homo sapiens
Sequence 2:NP_524367.1 Gene:Act88F / 41885 FlyBaseID:FBgn0000047 Length:376 Species:Drosophila melanogaster


Alignment Length:212 Identity:44/212 - (20%)
Similarity:79/212 - (37%) Gaps:53/212 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   226 LEHGTDPNIPDEYGNTALHYAIYNEDKLMAK--ALLLYGADIESK-NKHGLTPLLL------GVH 281
            :|||...|..|.  ....|:..|||.::..:  .:||..|.:..| |:..:|.::.      .::
  Fly    72 IEHGIITNWDDM--EKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMY 134

Human   282 EQKQQVVKFLIKKKAN---LNALDRYGRTVLILAVCCGSASIVSLLLEQNIDVSSQDLSG----- 338
            ...|.|:......:..   |::.|....||.|..   |.|...::|   .:|::.:||:.     
  Fly   135 VAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYE---GFALPHAIL---RLDLAGRDLTDYLMKI 193

Human   339 ---------QTAREYAVSSRHNVICQLLSDYKEKQILKVSSENSNPEQDLKLTSEEESQRLK--- 391
                     .||....|......:|.:..|::::.....:|           ||.|:|..|.   
  Fly   194 LTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAAS-----------TSLEKSYELPDGQ 247

Human   392 ----GSENSQ-PEEMSQ 403
                |:|..: ||.:.|
  Fly   248 VITIGNERFRCPEALFQ 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POTEMNP_001138914.1 Ank_4 143..193 CDD:290365
ANK 167..292 CDD:238125 17/74 (23%)
ANK 1 172..201
ANK repeat 174..203 CDD:293786
Ank_2 177..269 CDD:289560 13/45 (29%)
ANK repeat 205..236 CDD:293786 4/9 (44%)
ANK 2 205..234 3/7 (43%)
ANK 233..357 CDD:238125 29/149 (19%)
ANK repeat 238..269 CDD:293786 8/33 (24%)
ANK 3 238..267 7/30 (23%)
Ank_2 243..335 CDD:289560 21/103 (20%)
ANK repeat 271..302 CDD:293786 4/39 (10%)
ANK 4 271..300 4/37 (11%)
ANK repeat 304..335 CDD:293786 7/30 (23%)
ANK 5 304..333 7/28 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 369..487 11/43 (26%)
Act88FNP_524367.1 PTZ00281 1..376 CDD:173506 44/212 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100127
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.