DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment XYLT1 and WSC2

DIOPT Version :10

Sequence 1:NP_071449.1 Gene:XYLT1 / 64131 HGNCID:15516 Length:959 Species:Homo sapiens
Sequence 2:NP_014116.1 Gene:WSC2 / 855438 SGDID:S000005227 Length:503 Species:Saccharomyces cerevisiae


Alignment Length:139 Identity:30/139 - (21%)
Similarity:45/139 - (32%) Gaps:42/139 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   186 PSRQKELLKRKLEQQEKGKGHTF-----PGKGPGEVLPPGDRAAANSSHGKDVSRPPHARKTGGS 245
            |||....|       .|....||     |.:.||    ..|......:|  ::|:..|       
Yeast   391 PSRNNTAL-------SKNTASTFATYDLPTRAPG----GRDSIITGDAH--NISKRSH------- 435

Human   246 SPETKYDQPPKCDISGKEAISALSRAKSKHCRQEIGETYCRHKLGLLMPEKVTRFCPLEGKANKN 310
            .|...|::||.. .:|.:..||.|.......||          |.::.|:.|:      .....|
Yeast   436 FPSVVYEEPPSI-YNGNQRFSATSLPDMMEERQ----------LHIVNPDNVS------SNIGSN 483

Human   311 VQWDEDSVE 319
            |...:|..:
Yeast   484 VSDGDDDYD 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XYLT1NP_071449.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..259 18/77 (23%)
Branch 328..581 CDD:452742
Xylo_C 613..792 CDD:463618
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 940..959
WSC2NP_014116.1 WSC 25..118 CDD:214616
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.