DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment XYLT1 and WSC3

DIOPT Version :10

Sequence 1:NP_071449.1 Gene:XYLT1 / 64131 HGNCID:15516 Length:959 Species:Homo sapiens
Sequence 2:NP_014536.1 Gene:WSC3 / 854046 SGDID:S000005465 Length:556 Species:Saccharomyces cerevisiae


Alignment Length:105 Identity:23/105 - (21%)
Similarity:39/105 - (37%) Gaps:18/105 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   852 PEEA-LKLHNGPLRNAYMEQSFQSLNPVLSLPINPAQVEQARRNAASTGTALEGWLDSLVGGMWT 915
            ||.| :.|.||  .:.|...|...|..:            .:...::.||...||...:.||. :
Yeast    75 PESAVVALFNG--SDCYCGNSVSFLTSL------------TKSTDSNCGTKCSGWPYQMCGGS-S 124

Human   916 AMDICATGPTACPVMQTCSQTAWS--SFSPDPKSELGAVK 953
            .|::.....|....:::.|....|  |:.|...|.|.:.:
Yeast   125 YMNVYVNAETFVSSVESSSSKEGSSTSYMPSTTSSLSSAQ 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XYLT1NP_071449.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..259
Branch 328..581 CDD:452742
Xylo_C 613..792 CDD:463618
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 940..959 4/14 (29%)
WSC3NP_014536.1 WSC 39..132 CDD:214616 16/71 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.