DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC39A8 and Zip99C

DIOPT Version :9

Sequence 1:XP_024309952.1 Gene:SLC39A8 / 64116 HGNCID:20862 Length:475 Species:Homo sapiens
Sequence 2:NP_001189313.1 Gene:Zip99C / 43533 FlyBaseID:FBgn0039714 Length:355 Species:Drosophila melanogaster


Alignment Length:341 Identity:79/341 - (23%)
Similarity:132/341 - (38%) Gaps:65/341 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   129 WGYGFLSVTIINLASLLGLILTP----LIKKSY----FPKILTFFVGLAIGTLFSNAIFQLIPEA 185
            |.:..|...:|.|:.:..||:.|    :.|:.|    ..|:|...:..|:|.|..:....|:|||
  Fly    36 WVFSLLGSVVIGLSGIFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA 100

Human   186 F---GFDPKVDSYVEKAVAVFGGFYLLFFFERMLKMLLKTYGQNGHTHFGNDNFGPQEKTHQPKA 247
            :   ..||.....:...:.|..|..:....|::.         :|:.       ...|:..|||.
  Fly   101 WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIF---------SGYA-------SADEENPQPKC 149

Human   248 LPAIN------GVTCYANPAVTEANGHIHFDNVSVVSL--------QDGKKEPSSCTCLKGPKLS 298
            :...|      |.............|....::|..|..        ::.|::|..          
  Fly   150 VEIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKERKEQPKK---------- 204

Human   299 EIGTIAWMITLCDALHNFIDGLAIGASCTLSLLQGLSTSIAILCEEFPHELGDFVILLNAGMSTR 363
               ...::..|.:::.||..|||:..|..:|...|:..:.|||..|.|||:|||.|||.:|.|..
  Fly   205 ---VAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPHEVGDFAILLRSGFSRW 266

Human   364 QALLFNFLSACSCYVGL-----AFGILVGNNFAPNIIFALAGGMFLYISLADMFPEMNDMLREKI 423
            .|.....|:|.:..:|.     ..|:........:.|.....|.||:|:|..:.|   |:|:|:.
  Fly   267 DAARAQLLTAGAGLLGALVAIGGSGVTSAMEARTSWIMPFTAGGFLHIALVTVLP---DLLKEEE 328

Human   424 IKWATDDIKSQLHLLW 439
            .|   :.||..|.|::
  Fly   329 RK---ESIKQLLALVF 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC39A8XP_024309952.1 Zip 126..422 CDD:308248 73/322 (23%)
Zip99CNP_001189313.1 Zip 34..350 CDD:280666 79/341 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D657777at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.