DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC39A8 and Zip88E

DIOPT Version :9

Sequence 1:XP_024309952.1 Gene:SLC39A8 / 64116 HGNCID:20862 Length:475 Species:Homo sapiens
Sequence 2:NP_650440.2 Gene:Zip88E / 41847 FlyBaseID:FBgn0038312 Length:366 Species:Drosophila melanogaster


Alignment Length:347 Identity:79/347 - (22%)
Similarity:141/347 - (40%) Gaps:87/347 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   134 LSVTIINLASLLGLILTPLI---KKSYFPKILTFFVGLAIGTLFSNAIFQLIPEAFGFDPKVDS- 194
            |::.::.|.|||..:|...|   .:..||...:..:....|.|.:.|:..::||.   ..::|| 
  Fly    30 LAMLVLGLGSLLFGLLPAFISERNRRRFPLTASLLLCFGAGILLATALVHILPEV---REQMDSK 91

Human   195 YVEKAVAVFGGFYLLFFFERMLKMLLKTYGQNGHTHFG------------NDN-FGPQEKTHQPK 246
            :.|  ||:.|||::::|.:..:........|:.|.|..            ||| :|..:     :
  Fly    92 FAE--VAMCGGFFIIYFIDEFIHYFFGEAIQHTHAHDAETPATEPPRRPTNDNGYGAVD-----E 149

Human   247 ALPAINGVTCYANPAVTEANGHIHFDN------VSVVSLQDGKKEPSSC---------TCLKGPK 296
            ..|.::     |.|..:..:.|.|..:      .|.....|...|.::.         .|.:   
  Fly   150 RAPLLS-----AEPNTSHGHSHHHSHDHDHNHPASASGCNDASVEDANARICHTSHTEPCAQ--- 206

Human   297 LSEIGTIAWMITLCDALHNFIDGLAIGASCTLSLLQGLSTSI-----AILCEEFPHELGDFVILL 356
             |..||:...:.|  :||:.|:|||||       :|..||.:     |:.|.:|   :..|.:.|
  Fly   207 -SMTGTLGLFVAL--SLHSAIEGLAIG-------VQNSSTKVLFLLGAVACHKF---VMGFCLGL 258

Human   357 ----NAGMSTRQALLFNFLSACSCYVGLAFGILV-------GNNFAPNIIFALAGGMFLYISLAD 410
                |...|.|...:...:.|....:|:..|:|:       .:...| |:.|||||...|:::.:
  Fly   259 EFRSNPQTSFRAQFVGISVFALGAVIGIGLGMLIVDVPAAWSSKTLP-IVQALAGGTLFYVTVCE 322

Human   411 MFPEMNDMLREKIIKWATDDIK 432
            :.|      ||| .:|.::..:
  Fly   323 VIP------REK-ARWHSNSTR 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC39A8XP_024309952.1 Zip 126..422 CDD:308248 76/335 (23%)
Zip88ENP_650440.2 Zip 26..359 CDD:280666 79/347 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.