DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SELP and CG7763

DIOPT Version :9

Sequence 1:NP_002996.2 Gene:SELP / 6403 HGNCID:10721 Length:830 Species:Homo sapiens
Sequence 2:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster


Alignment Length:175 Identity:39/175 - (22%)
Similarity:67/175 - (38%) Gaps:25/175 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     1 MANCQIAILYQRFQRVVFGIS------------QLLCFSALISELTNQKEV---AAWTYHYSTK- 49
            :|..:||:..:|...  ||.|            |||.....:.....:.|:   ....|:|..| 
  Fly    60 VAIARIALNDRRLDN--FGTSTNLQLENQNTSQQLLTHGTAMGRKLEENEIFQQLGSKYYYIEKE 122

Human    50 -AYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNE 113
             ..:|:.:...|......|.::|::.|:|..|..|...:. |||.:........:|...|.....
  Fly   123 EKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNR-YWIDVTNQFNESEFVSVTKGSKAN 186

Human   114 AENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALC 158
            ..:|||.||.   .:.:||:  |::.:.....||..|....:.:|
  Fly   187 FLSWADGEPT---KDGECVD--IRTFNGKTTMNDNSCFANLYFIC 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SELPNP_002996.2 CLECT_selectins_like 42..160 CDD:153062 28/119 (24%)
EGF_CA <168..195 CDD:238011
CCP 200..257 CDD:153056
CCP 262..320 CDD:153056
CCP 324..382 CDD:153056
CCP 386..444 CDD:153056
CCP 448..506 CDD:153056
PHA02927 505..761 CDD:222943
CCP 510..568 CDD:153056
CCP 572..630 CDD:153056
CCP 642..700 CDD:153056
CCP 704..762 CDD:153056
Endocytosis signal. /evidence=ECO:0000305 818..821
Interaction with SNX17 821..830
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 28/117 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.