DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BLK and wnd

DIOPT Version :9

Sequence 1:XP_011542126.1 Gene:BLK / 640 HGNCID:1057 Length:531 Species:Homo sapiens
Sequence 2:NP_649137.3 Gene:wnd / 40143 FlyBaseID:FBgn0036896 Length:977 Species:Drosophila melanogaster


Alignment Length:307 Identity:95/307 - (30%)
Similarity:155/307 - (50%) Gaps:54/307 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   232 DEWEIPRQSLRLVRKLGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLGEANV--MKALQHE 294
            ::|:||.:|:..:..||||..|.|:.|..||. .||:|.:||        |.|.::  ::.|.||
  Fly   152 EDWQIPFESITELEWLGSGAQGAVFSGRLKNE-TVAVKKVKE--------LKETDIKHLRKLDHE 207

Human   295 RLVRLYAVVTKEPIY-IVTEYMARGGAPRRAASSERGGRAGLSRRRRVRC--GCLLDFLKTDEGS 356
            .:::...|.|:.|:: |:.|:                            |  |.|.:.||.::  
  Fly   208 NIIKFKGVCTQSPVFCIIMEF----------------------------CPYGPLQNILKEEQ-- 242

Human   357 RLSLP-RLIDMSAQIAEGMAYIERMNSIHRDLRAANILVSEALCCKIADFGLARIIDSEYTAQEG 420
             :.|| ||:..|.|||.||.|:.....|||||::.|||:|.....||:|||.:|.. :|.:.:..
  Fly   243 -VMLPSRLVSWSKQIALGMQYLHSHKIIHRDLKSPNILISTNEVVKISDFGTSREW-NEISTKMS 305

Human   421 AKFPIKWTAPEAIHFGVFTIKADVWSFGVLLMEVVTYGRVPYPGMSNPEVIRNL-ERGYRMPRPD 484
            ....:.|.|||.|.....:.|.|:||:||:|.|::|. .:||..:.:..:|..: ....::..|.
  Fly   306 FAGTVAWMAPEVIRNEPCSEKVDIWSYGVVLWEMLTC-EIPYKDVDSSAIIWGVGNNSLKLLVPS 369

Human   485 TCPPELYRGVIAECWRSRPEERPTFEFLQSVLE----DFYTATERQY 527
            || ||.::.::..||:|:|..||:|..:.|.|:    :....||:||
  Fly   370 TC-PEGFKLLVKLCWKSKPRNRPSFRQILSHLDIAGPELLRKTEKQY 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BLKXP_011542126.1 SH3_Blk 62..115 CDD:212942
SH2_Src_Blk 120..219 CDD:198234
PKc_like 233..522 CDD:304357 91/299 (30%)
Pkinase_Tyr 241..516 CDD:285015 86/281 (31%)
wndNP_649137.3 STYKc 161..400 CDD:214568 86/281 (31%)
STKc_MAP3K12_13 167..403 CDD:270961 87/278 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.