DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment NEUROG2 and CG33557

DIOPT Version :9

Sequence 1:	NP_076924.1	Gene:	NEUROG2 / 63973	HGNCID:	13805	Length:	272	Species:	Homo sapiens
Sequence 2:	NP_001014730.1	Gene:	CG33557 / 3346145	FlyBaseID:	FBgn0053557	Length:	150	Species:	Drosophila melanogaster

Alignment Length:	137	Identity:	42/137 - (30%)
Similarity:	56/137 - (40%)	Gaps:	34/137 - (24%)

- Green bases have known domain annotations that are detailed below.

Human    38 DEEEEEEPGASGGARRQRGAEAGQGARGGVAAGAEGCRPARLLGLVHDCKRRPSRARAVSRGAKT 102
            |.........||.|.....::.||.|..|   |.|.         ..:.:|||.|.
  Fly    21 DSNSSGSASGSGAAADSEDSQIGQEANPG---GQEN---------QGNHRRRPPRQ--------- 64

Human   103 AETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTET 167
                         |.|.|||.|..|:|:|.:|||.::||.|.:.||:|||.:|.|.:||..|:.|
  Fly    65 -------------KINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSST 116

Human   168 LRLADHC 174
            |.....|
  Fly   117 LETGTEC 123

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
NEUROG2	NP_076924.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	30..69		8/30 (27%)
		bHLH_TS_NGN2_ATOH4	104..172	CDD:381560	27/67 (40%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	197..264
CG33557	NP_001014730.1	HLH	67..119	CDD:197674	26/51 (51%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910