DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MRPS14 and mrps14

DIOPT Version :9

Sequence 1:NP_071383.1 Gene:MRPS14 / 63931 HGNCID:14049 Length:128 Species:Homo sapiens
Sequence 2:XP_002931484.1 Gene:mrps14 / 100485757 XenbaseID:XB-GENE-975794 Length:131 Species:Xenopus tropicalis


Alignment Length:131 Identity:98/131 - (74%)
Similarity:116/131 - (88%) Gaps:3/131 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAAFMLGSLLRTFKQMVP---SSASGQVRSHYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTI 62
            |||.||||:.|:.:|:.|   ::.:.|||::||||||:||||||||||||||||||:|:||||.|
 Frog     1 MAASMLGSVFRSARQLFPWPSATCTNQVRNYYVDWRMFRDVKRRKMAYEYADERLRVNALRKNII 65

Human    63 LPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRAT 127
            |||.|::|||:||||.|.||||||||||||:|||||||||||||||||||||||:.|:||||||.
 Frog    66 LPKELREVADKEIAAFPVDSCPVRIRNRCVLTSRPRGVKRRWRLSRIVFRHLADNNQMSGIQRAM 130

Human   128 W 128
            |
 Frog   131 W 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MRPS14NP_071383.1 Ribosomal_S14 74..126 CDD:395195 45/51 (88%)
mrps14XP_002931484.1 Ribosomal_S14 39..131 CDD:381968 78/91 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 105 1.000 Domainoid score I29002
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41467
Inparanoid 1 1.050 202 1.000 Inparanoid score I11998
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612572at2759
OrthoFinder 1 1.000 - - FOG0003806
OrthoInspector 1 1.000 - - oto148175
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1255
SonicParanoid 1 1.000 - - X6370
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.090

Return to query results.
Submit another query.