DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TNN and CG31832

DIOPT Version :9

Sequence 1:XP_016857537.1 Gene:TNN / 63923 HGNCID:22942 Length:1317 Species:Homo sapiens
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:227 Identity:95/227 - (41%)
Similarity:129/227 - (56%) Gaps:19/227 - (8%)


- Green bases have known domain annotations that are detailed below.


Human  1073 TTLSTVGARFPHPSDCSQVQQNSNAASGLYTIYLHGDASRPLQVYCDMETDGGGWIVFQRRNTGQ 1137
            |.|..||...||  .|.     |.:.:|::.:.|  ....|.|| ...:|....|||.|||..|.
  Fly    12 TLLFEVGQSSPH--TCP-----SGSPNGIHQLML--PEEEPFQV-TQCKTTARDWIVIQRRLDGS 66

Human  1138 LDFFKRWRSYVEGFGDPMKEFWLGLDKLHNLTTGTPARYEVRVDLQTA-NESAYAIYDFFQVASS 1201
            ::|.:.|.||.:|||||..||::||.||:.:|...|  :|:.:.|:.. ..:.||.:|.|||.|.
  Fly    67 VNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQP--HELFIQLKHGPGATVYAHFDDFQVDSE 129

Human  1202 KERYKL-TVGKYRGTAGDALTYHNGWKFTTFDRDNDIALSNCALTHHGGWWYKNCHLANPNGRY- 1264
            .|.||| .||||.|||||:|.||...:|:|||||||.:..|||..|.||||:.:|..::.||.| 
  Fly   130 TELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYF 194

Human  1265 --GETKHSEGVNWEPWKGHEFSIPYVELKIRP 1294
              |||....|::|..||..  |:.:|::.|||
  Fly   195 REGETGMLNGIHWGRWKFQ--SLTFVQIMIRP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TNNXP_016857537.1 None
CG31832NP_723894.2 FReD 28..225 CDD:238040 87/204 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.