DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GALNT11 and Pgant3

DIOPT Version :9

Sequence 1:NP_001358393.1 Gene:GALNT11 / 63917 HGNCID:19875 Length:667 Species:Homo sapiens
Sequence 2:NP_610256.1 Gene:Pgant3 / 35627 FlyBaseID:FBgn0027558 Length:667 Species:Drosophila melanogaster


Alignment Length:606 Identity:215/606 - (35%)
Similarity:319/606 - (52%) Gaps:75/606 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    22 VLLFVYFNFSEVTQPLKNVPVKGSGPHGPSPKKFYPRFTRGPSRVLEPQFKANKIDDVIDSRVED 86
            :|.|.:|.|: ::..|....::|.......||....|.:..|.:.:...:...  .|:..:...|
  Fly    18 LLFFAFFMFA-ISINLYVASIQGGDAEMRHPKPPPKRRSLWPHKNIVAHYIGK--GDIFGNMTAD 79

Human    87 PEEGHLKFSSELG-------MIFNERDQELRDLGYQKHAFNMLISDRLGYHRDVPDTRNAACKEK 144
            ....:| |....|       ::...||:......::.::||:|.|||:..:|.:.|.|...|::|
  Fly    80 DYNINL-FQPINGEGADGRPVVVPPRDRFRMQRFFRLNSFNLLASDRIPLNRTLKDYRTPECRDK 143

Human   145 FYPPDLPAASVVICFYNEAFSALLRTVHSVIDRTPAHLLHEIILVDDDSDFDDLKGELDEYVQKY 209
            .|...||:.||:|.|:|||:|.||||:.|||:|:|.|||.|||||||.||...||.:|:.|| |.
  Fly   144 KYASGLPSTSVIIVFHNEAWSVLLRTITSVINRSPRHLLKEIILVDDASDRSYLKRQLESYV-KV 207

Human   210 LPGKIKVIRNTKREGLIRGRMIGAAHATGEVLVFLDSHCEVNVMWLQPLLAAIREDRHTVVCPVI 274
            |....::.|..||.||:..|::||.:|.|:||.|||:|||.:..||:|||:.|:|.|..|:||||
  Fly   208 LAVPTRIFRMKKRSGLVPARLLGAENARGDVLTFLDAHCECSRGWLEPLLSRIKESRKVVICPVI 272

Human   275 DIISADTLAYSSSPVVR-GGFNWGLHFKW---DLVPLSELGRAEGATAPIKSPTMAGGLFAMNRQ 335
            ||||.|..:|:.:.... |.|||.|.|:|   |....:....::.:|.||.:|.|||||||::|:
  Fly   273 DIISDDNFSYTKTFENHWGAFNWQLSFRWFSSDRKRQTAGNSSKDSTDPIATPGMAGGLFAIDRK 337

Human   336 YFHELGQYDSGMDIWGGENLEISFRIWMCGGKLFIIPCSRVGHIFRKRRPYGSPEG-QDTMTHNS 399
            ||:|:|.|||.|.:|||||:|:|||||.|||::.|.|||.|||:||...||..|.| .:.:|.|.
  Fly   338 YFYEMGSYDSNMRVWGGENVEMSFRIWQCGGRVEISPCSHVGHVFRSSTPYTFPGGMSEVLTDNL 402

Human   400 LRLAHVWLDEYKEQYFSL----RPDLKTKSYGNISERVELRKKLGCKSFKWYLDNVYPE------ 454
            .|.|.||:|::  |||.:    ...|..|...|::|||.||::|.||.|.|||:|::||      
  Fly   403 ARAATVWMDDW--QYFIMLYTSGLTLGAKDKVNVTERVALRERLQCKPFSWYLENIWPEHFFPAP 465

Human   455 ----------------MQISGSHAKPQQPIFVNRGPKR------PKVLQRGRLYHLQTNKCLVAQ 497
                            .|....|.|......::|..||      .|..:...|..|:.:|||   
  Fly   466 DRFFGKIIWLDGETECAQAYSKHMKNLPGRALSREWKRAFEEIDSKAEELMALIDLERDKCL--- 527

Human   498 GRP-------SQKGGLVVLKACDYSDPNQIWIYNEEHELVLNSLLCL----------DMSETRSS 545
             ||       |....:.|.....::....:::...:.:::.|..:||          .|.:.|::
  Fly   528 -RPLKEDVPRSSLSAVTVGDCTSHAQSMDMFVITPKGQIMTNDNVCLTYRQQKLGVIKMLKNRNA 591

Human   546 DPPRLM--KCHGSGGSQQWTF 564
            ....:|  :| .|..||.||:
  Fly   592 TTSNVMLAQC-ASDSSQLWTY 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GALNT11NP_001358393.1 Catalytic subdomain A 150..261 61/110 (55%)
pp-GalNAc-T 154..452 CDD:133004 154/306 (50%)
Catalytic subdomain B 319..381 40/61 (66%)
Ricin_B_lectin 483..>564 CDD:366226 20/99 (20%)
Pgant3NP_610256.1 Glyco_tranf_2_3 150..386 CDD:290369 125/236 (53%)
pp-GalNAc-T 153..457 CDD:133004 154/306 (50%)
Ricin_B_lectin 516..658 CDD:279046 21/101 (21%)
RICIN 524..660 CDD:238092 19/93 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.