DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GALNT11 and Pgant2

DIOPT Version :9

Sequence 1:NP_001358393.1 Gene:GALNT11 / 63917 HGNCID:19875 Length:667 Species:Homo sapiens
Sequence 2:NP_608773.2 Gene:Pgant2 / 33556 FlyBaseID:FBgn0031530 Length:633 Species:Drosophila melanogaster


Alignment Length:513 Identity:225/513 - (43%)
Similarity:296/513 - (57%) Gaps:62/513 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    88 EEGHLKFSSELGMIFNERDQELRDLGYQKHAFNMLISDRLGYHRDVPDTRNAACKEKFYPPDLPA 152
            |.|:::    .|.:.|..|.      |.::.||...||.|..:||:|||||..|:.|.|..|||.
  Fly   149 EAGYIR----AGALRNGEDP------YIRNRFNQEASDALPSNRDIPDTRNPMCRTKKYREDLPE 203

Human   153 ASVVICFYNEAFSALLRTVHSVIDRTPAHLLHEIILVDDDSDFDDLKGELDEYVQKYLPGKIKVI 217
            .||:|.|:|||.|.||||:.||::|:|.||:.||:||||.||..:...||.:.      .|::||
  Fly   204 TSVIITFHNEARSTLLRTIVSVLNRSPEHLIREIVLVDDYSDHPEDGLELAKI------DKVRVI 262

Human   218 RNTKREGLIRGRMIGAAHATGEVLVFLDSHCEVNVMWLQPLLAAIREDRHTVVCPVIDIISADTL 282
            ||.|||||:|.|:.||..|...||.|||||.|.|.|||:|||..:|||...|||||||:||.|..
  Fly   263 RNDKREGLVRSRVKGADAAVSSVLTFLDSHVECNEMWLEPLLERVREDPTRVVCPVIDVISMDNF 327

Human   283 AY-SSSPVVRGGFNWGLHFKWD-LVPLSELGRAEGATAPIKSPTMAGGLFAMNRQYFHELGQYDS 345
            .| .:|..:||||:|.|.|||: |.|.....|....|..|::|.:|||||.:::.||::||:||.
  Fly   328 QYIGASADLRGGFDWNLIFKWEYLSPSERAMRHNDPTTAIRTPMIAGGLFVIDKAYFNKLGKYDM 392

Human   346 GMDIWGGENLEISFRIWMCGGKLFIIPCSRVGHIFRKRRPYGSPEGQ-DTMTHNSLRLAHVWLDE 409
            .||:|||||||||||:|.|||.|.|||||||||:||||.||..|.|. :....|:.|.|.||:|:
  Fly   393 KMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKRHPYTFPGGSGNVFARNTRRAAEVWMDD 457

Human   410 YKEQYFSLRPDLKTKSYGNISERVELRKKLGCKSFKWYLDNVYPEMQISGSHAKPQQ-------- 466
            ||:.|::..|..|...:|||.:|:.|::||.||.|||||:||||::|.    ..||:        
  Fly   458 YKQHYYNAVPLAKNIPFGNIDDRLALKEKLHCKPFKWYLENVYPDLQA----PDPQEVGQFRQDS 518

Human   467 ------------------PIFVNRGPKRPKVLQRGRLYHLQTNKCLVAQGRPSQKGGLVVLKACD 513
                              |.....|.:.....:||.:.|......||...|.||    |||||||
  Fly   519 TECLDTMGHLIDGTVGIFPCHNTGGNQEWAFTKRGEIKHDDLCLTLVTFARGSQ----VVLKACD 579

Human   514 YSDPNQIWIYNE----EHELVLNSLLCLDMSETRSSDPPRLMKCHGSGGSQQWTFGYF 567
            .|: ||.||..|    .|..:   .:||| |..:|........|:.:.|:|:|:||.:
  Fly   580 DSE-NQRWIMREGGLVRHYKI---NVCLD-SRDQSQQGVSAQHCNSALGTQRWSFGKY 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GALNT11NP_001358393.1 Catalytic subdomain A 150..261 60/110 (55%)
pp-GalNAc-T 154..452 CDD:133004 160/300 (53%)
Catalytic subdomain B 319..381 40/61 (66%)
Ricin_B_lectin 483..>564 CDD:366226 30/84 (36%)
Pgant2NP_608773.2 WcaA 200..>432 CDD:223539 133/237 (56%)
pp-GalNAc-T 205..500 CDD:133004 160/300 (53%)
Ricin_B_lectin 511..627 CDD:279046 32/124 (26%)
RICIN 513..629 CDD:238092 33/124 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.