DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GALNT11 and Pgant4

DIOPT Version :10

Sequence 1:NP_001358393.1 Gene:GALNT11 / 63917 HGNCID:19875 Length:667 Species:Homo sapiens
Sequence 2:NP_722910.2 Gene:Pgant4 / 261610 FlyBaseID:FBgn0051956 Length:644 Species:Drosophila melanogaster


Alignment Length:50 Identity:14/50 - (28%)
Similarity:21/50 - (42%) Gaps:5/50 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    80 IHTVEKPYKCYECGK-AFNWSSHLQIHMRVHTGEKPYVCSECGR----GF 124
            ||.:.:.|...:..| ..|::|:.....||....:|...|..||    ||
  Fly   178 IHNIPQSYTNEDLRKMIINFTSYRPRECRVMRDNRPSFGSAAGRSRGYGF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GALNT11NP_001358393.1 Catalytic subdomain A 150..261
pp-GalNAc-T 154..452 CDD:133004
Catalytic subdomain B 319..381
beta-trefoil_Ricin_GALNT11 478..>565 CDD:467318
Pgant4NP_722910.2 pp-GalNAc-T 181..480 CDD:133004 11/46 (24%)
beta-trefoil_Ricin_Pgant9-like 493..629 CDD:467340
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.