DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xiap and Bruce

DIOPT Version :9

Sequence 1:XP_006257568.1 Gene:Xiap / 63879 RGDID:620692 Length:536 Species:Rattus norvegicus
Sequence 2:NP_001262460.1 Gene:Bruce / 41260 FlyBaseID:FBgn0266717 Length:4976 Species:Drosophila melanogaster


Alignment Length:305 Identity:74/305 - (24%)
Similarity:109/305 - (35%) Gaps:69/305 - (22%)


- Green bases have known domain annotations that are detailed below.


  Rat   200 MCSEEARLKTFQNWP--DYAHLSPRELASAGLYY---TGIDDQVQCFCCGGKLKNWEPCDRAWSE 259
            |.||..|.:||:.||  ||....|.::|.||.|:   :..:|:..||.|...|..||..|..|||
  Fly   245 MHSEAVRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEPWSE 309

  Rat   260 HRRHFPNCFFVLGRNVNVRSESGVSSDRNFPNSTNSPRNPAMAEYDARIVTFGTWLYSVNKEQLA 324
            |.||.|.|.||.|...           :|.|.|.....|||:                    ...
  Fly   310 HERHSPLCPFVKGEYT-----------QNVPLSITYATNPAL--------------------PAP 343

  Rat   325 RAGFYALGEGD--KVKCFHCG--GGLTDWKPSEDPWEQHAKWYPG-CKYLLDE------------ 372
            ..||..:...|  .|.|..|.  |.|:.|.........|....|. ..|:.:|            
  Fly   344 GLGFDIISNSDYANVLCTSCSQTGELSVWSIERHLKLMHTFHVPTLLNYIFEESFEWARVTAICV 408

  Rat   373 ----KGQEYINNIHLTHSLGESVVRTAEKTPSVTKKIDDTIFQNPMVQ-----EAIRMGFNFKDI 428
                :.:..:|.::...:.|.|.........|....:....|.:...|     ..:|.|.....|
  Fly   409 LPNARARTKVNYVYSAANYGGSGSSNGAGCNSGLNAVSGGKFGSVNAQHITSTSTLRAGVVGSKI 473

  Rat   429 KKTMEEKLQTSGSNYLSLEVLIADLVSAQKDNSQDESSQTSLQKD 473
            ...:..: |:||.  |:|.:::.::|...: ||:   |.||:..|
  Fly   474 VLGVSVR-QSSGE--LALRMVVLNIVEVDR-NSE---SSTSVSND 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XiapXP_006257568.1 BIR 68..135 CDD:237989
BIR 202..272 CDD:197595 32/74 (43%)
BIR 304..370 CDD:197595 12/70 (17%)
UBA_BIRC4_8 409..458 CDD:270578 11/53 (21%)
zf-C3HC4_3 485..528 CDD:290631
BruceNP_001262460.1 BIR 251..321 CDD:279047 29/69 (42%)
DUF3643 3539..3664 CDD:289152
UQ_con 4636..4790 CDD:278603
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.