DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SDC2 and Sdc

DIOPT Version :9

Sequence 1:NP_002989.2 Gene:SDC2 / 6383 HGNCID:10659 Length:201 Species:Homo sapiens
Sequence 2:NP_001163238.2 Gene:Sdc / 37447 FlyBaseID:FBgn0010415 Length:495 Species:Drosophila melanogaster


Alignment Length:249 Identity:68/249 - (27%)
Similarity:102/249 - (40%) Gaps:71/249 - (28%)


- Green bases have known domain annotations that are detailed below.


Human     9 TLGLVACVSAESRAELTSDKDMYLDNSSI-----------EEASGVYPIDDDDYASASGSGADED 62
            |..|...:.||.:..|....|..||..|.           :|..|    ||.||........:.|
  Fly   262 TTTLAPTIPAEPQQPLFPPFDKDLDTESSGDGIDADAEDDDEDDG----DDKDYDYNKELDKEID 322

Human    63 VESPELTTSRP--LPKILLTSAAPKVETTTLNIQNKIPA-----QTKSPEETDKEKVHLSDSE-- 118
            ::.||     |  ||.::..:.   |||..:...::|..     ......:.|..::..:|.:  
  Fly   323 IDGPE-----PGHLPPVVHHNT---VETGHIPTTDEIDVDGGDEDDNGDSDIDGPRIGGNDGDIT 379

Human   119 -----------RKMDPAEEDTNVYT----------------------EKHSDSLFKRTEVLAAVI 150
                       .::||   :|||.:                      :..:.|.|.:..:|||||
  Fly   380 ERGPGAGGSNVHELDP---NTNVNSQPSDTKGIDHRPNGNEVVIMSEDDRTSSFFSQPGILAAVI 441

Human   151 AGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGE--RKPSSAAYQK-APTKEFYA 201
            .|.|:|.|.||.:::.:||||||||||||.|.|  |.|::.:|.| |..:||||
  Fly   442 GGAVVGLLCAILVVMFIVYRMRKKDEGSYALDEPKRSPANNSYAKNANNREFYA 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SDC2NP_002989.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..70 8/27 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..130 6/57 (11%)
Syndecan 138..199 CDD:279386 32/63 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..201 11/25 (44%)
SdcNP_001163238.2 Syndecan 429..493 CDD:279386 32/63 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142171
Domainoid 1 1.000 63 1.000 Domainoid score I10249
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003556
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10915
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4983
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.