DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCAN and lectin-22C

DIOPT Version :9

Sequence 1:XP_016857536.1 Gene:BCAN / 63827 HGNCID:23059 Length:956 Species:Homo sapiens
Sequence 2:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster


Alignment Length:118 Identity:35/118 - (29%)
Similarity:52/118 - (44%) Gaps:10/118 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   742 GACYKHFS--TRRSWEEAETQCRMYGAHLASISTPEEQDFINNRYRE--YQWIGLNDRTIEGDFL 802
            |:.|.:..  :.::|..|...||..|.|||.|....:...|....:|  :.|:|:||...||.||
  Fly   143 GSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTHYWLGINDLDHEGKFL 207

Human   803 -WSDGVPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCK 854
             ...|....:..|..|:|..  |...|||.:.   .|:..|.||:|...:.|:
  Fly   208 SMPTGKQTTFLKWASGRPSQ--LDTLNCVFLY---NGEMYDYPCHYTFRFICQ 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCANXP_016857536.1 None
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 33/113 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4956
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.