DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCAN and tfc

DIOPT Version :9

Sequence 1:XP_016857536.1 Gene:BCAN / 63827 HGNCID:23059 Length:956 Species:Homo sapiens
Sequence 2:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster


Alignment Length:497 Identity:93/497 - (18%)
Similarity:163/497 - (32%) Gaps:211/497 - (42%)


- Green bases have known domain annotations that are detailed below.


Human   403 QPSAIPEASNPASNPASDGLE---AIVTVTETLEELQLPQEATES-------ESRGAIYSIPIME 457
            |.:.|..:||.:.:...:|.:   |.:..:|...:.|:.|:...:       .:|.|...||.:.
  Fly    44 QNNHISSSSNISRSGGGNGRDKRGAQLDPSEIARQNQITQQIFANYLERRLFPNRTANQKIPTIA 108

Human   458 DGGGGSSTPE-DPAEAPRTLLEFETQSMVPPTGFSEEEG-----------------KALEEEEKY 504
            |     ..|: .|:..||            |.||:..:|                 .|.:.:..|
  Fly   109 D-----ILPKPKPSPRPR------------PRGFAASDGGNFKRSGGGAQRNRLAAAASKRQSGY 156

Human   505 EDEEEKEEEEEEEEVEDEALWAWPSELSSPGPEASLPTEPAAQEESLS---QAPARAVLQPGASP 566
            ..:..:||:|||||.:|:                ....:|.|.:|...   |...::|       
  Fly   157 NRKRLREEQEEEEEADDQ----------------ERDQQPLANQEDFDYDVQESLQSV------- 198

Human   567 LPDGESEASRPPRVHGPPTETLPTPRERNLASPSPSTLVEAREVGEATGGPELSGVPRGESEETG 631
                  |:.:..:.:|            |:....||                       |:|   
  Fly   199 ------ESEQHDQYYG------------NIFHRDPS-----------------------ENE--- 219

Human   632 SSEGAPSLLPATRAPEGTRELEAPSEDNSGRTAPAGTSVQAQPVLPTDSASRGGVAVVPASGDCV 696
                                                                            |
  Fly   220 ----------------------------------------------------------------V 220

Human   697 PSPCHNGGTCLEEEEGVRCLCLPGYGGDLCDVGLRFCNPGWDAFQGACYKHFSTRRSWEEAETQC 761
            .:.|.|   |::|.:         |..:      ::..|.....:...|.....:.:|.:|...|
  Fly   221 DNDCPN---CVDESQ---------YTPN------KWTMPLLKLGEKRYYLGIFFKANWFKATQYC 267

Human   762 RMYGAHLASISTPEEQDFINNRYR------EYQWIGLNDRTIEGDFLW-SDGVPLLYENWNPGQP 819
            |.:|.||||||:.||.|.:....|      |:.||...|...||:|.| :.|.|:.:.|||.|:|
  Fly   268 RYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEP 332

Human   820 DSY-FLSG--ENCVVMVWHDQG---QWSDVPCNYHLSYTCKM 855
            ::: :.:|  |||:.: |:..|   :|:|.||::...:.|::
  Fly   333 NNFRYENGEEENCLEL-WNRDGKGLKWNDSPCSFETYFVCEV 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCANXP_016857536.1 None
tfcNP_612091.1 CLECT 249..373 CDD:153057 42/124 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8850
eggNOG 1 0.900 - - E33208_3BFQ9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S11806
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41755
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4956
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.