DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRR and GlcT

DIOPT Version :10

Sequence 1:NP_068766.1 Gene:SRR / 63826 HGNCID:14398 Length:340 Species:Homo sapiens
Sequence 2:NP_611636.1 Gene:GlcT / 37516 FlyBaseID:FBgn0067102 Length:440 Species:Drosophila melanogaster


Alignment Length:52 Identity:14/52 - (26%)
Similarity:25/52 - (48%) Gaps:8/52 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   151 VHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKP 202
            |...::||:     .:...:|.:.|||||.:. |||..:  |:...:..:.|
  Fly    88 VEDKEDPAI-----QLVERLLAKYPLVDAALF-VGGSDV--GVNPKINNIHP 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRRNP_068766.1 Trp-synth-beta_II 5..320 CDD:444852 14/52 (27%)
GlcTNP_611636.1 Glucosylceramide_synthase 52..281 CDD:133012 14/52 (27%)

Return to query results.
Submit another query.