DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN10A and Irc

DIOPT Version :9

Sequence 1:XP_005265428.1 Gene:SCN10A / 6336 HGNCID:10582 Length:1959 Species:Homo sapiens
Sequence 2:NP_001262653.1 Gene:Irc / 42049 FlyBaseID:FBgn0038465 Length:697 Species:Drosophila melanogaster


Alignment Length:782 Identity:143/782 - (18%)
Similarity:231/782 - (29%) Gaps:304/782 - (38%)


- Green bases have known domain annotations that are detailed below.


Human   443 TSLHSHN----------GSPLTSKNASERRHRIKPRV-SEGSTEDNKSPRSDPYNQRRMSFLGLA 496
            |:|.|.|          ||.:|.||.|....::...: |..|.:|||              |.| 
  Fly    48 TALDSVNRQKRLEDNLLGSDITVKNGSLSHAQLLDTLPSLASKKDNK--------------LAL- 97

Human   497 SGKRRASHGSVFHFRSPGRDISLPEGVTDDGVFPGDHESHRGSLLLGGGAGQQGPLPRSPLPQPS 561
                :....|:..|.|.    .||..:        |.:..|..|       :|.|||.....:..
  Fly    98 ----KILKSSLLVFNSE----CLPNNI--------DGDKCRSYL-------EQKPLPEGSSLRTE 139

Human   562 NPDSRHGEDE------------------HQPPPTS---ELAPGAVDVSA-------FDAGQKKTF 598
            ..:|..|..|                  :|..|.|   |..|.|..:|.       ....:::||
  Fly   140 CENSLKGNREGHYAFRRLLGSSHYRNGFYQMFPNSGRRETVPAAWSISKELYEPDHIQISKQQTF 204

Human   599 LSAEYLDEPFRAQRAMSVVSIITSVLEELEESEQKCPPCLTSLSQKYLIWDCCPMWVKLKTILFG 663
            .|...|..|..||          .|..:|.:      |...|:|....| :||..          
  Fly   205 ESNSNLALPQWAQ----------FVEHDLSK------PVSQSMSNGAPI-ECCSR---------- 242

Human   664 LVTDPFAELTITLCIVVNTIFMAMEHHGMSPTFEAMLQIGNIVFTIFFTAEMVFKIIAFDPYYYF 728
                             :.|.:...||  .|....:|                         |..
  Fly   243 -----------------DQINLQPRHH--HPACAPIL-------------------------YQP 263

Human   729 QKKWNIFDCI-----IVTVSLLELGVAKK-----GSLSVLRSF-------RLLRVFK--LAKSWP 774
            ..|:::..|:     .:.|:....|.|::     |||.:.:.:       |.|||.:  |.:|.|
  Fly   264 GGKYDVPSCLNYVRSALAVADCNFGGAEQLNQATGSLDLSQLYGFTAAAERKLRVLEGGLLRSTP 328

Human   775 T---LNTLIKIIGNSVG-------ALGNLTIILA-----------IIVFVFALVGKQLLGENYRN 818
            .   .|.|:.|..::.|       .:|:.|...|           |:::...:          ||
  Fly   329 RGEFDNALLPIATDTEGPSFCARATIGDGTCFAAGDSRVNSSPFSILIYTIFM----------RN 383

Human   819 NRKNISAPHEDWPRWHMHDFFHSFL-----IVFRILCGEWIENMWACMEVGQK------------ 866
            :.|..:...:..|||.....|.:..     |..|::..||:..:     :|||            
  Fly   384 HNKVAAELKQRNPRWSDEKLFQAAKAVNVDIYRRVVIEEWLPEV-----LGQKMSSEIRRKQPNR 443

Human   867 --------SICLILFLTVMVLGNLVVLNLFIALLLNSFSADNLTAPEDDGEVNNLQVALARIQVF 923
                    ::..|.|...|:...|  |||         :.||:..   ..|.||..|        
  Fly   444 ALEVSNEFAVAAIRFYFSMLPNEL--LNL---------TKDNVVY---GTEKNNQYV-------- 486

Human   924 GHRTKQALCSFFSRSCPFPQPKAEPELVV--KLPLSSSKAENHIAA----NTAR---GSSGGLQA 979
                      |.|:..|........|.:.  ||..:|.|..|.:.:    .|.:   ..|||:..
  Fly   487 ----------FISKELPTKNLFELKEEIYKPKLQYTSQKLNNILESLLNQETMKMDAAYSGGVVW 541

Human   980 PRGPRDEHSDFIANPTVWVSVPIAEGESDLDDLEDDGGEDAQSFQQEVIPKGQQEQLQQVERCGD 1044
            .:..:..|:|.:|              .|:....|.|......:.:..:.....|..:..|    
  Fly   542 HKDTKPTHADILA--------------FDIQRGRDHGLLPYYRYLESCVLSRPVESWKDFE---- 588

Human  1045 HLTPRSPGTGTSSEDLAPSLGETWKD-----ESVPQVPAEGVDDTSSSEGSTVDCLDPEEILRKI 1104
            |..|      :...|...::..:|.|     ..:.:.|..|      |.|.|..|:..|:.:..:
  Fly   589 HFIP------SDVLDKLKTIYASWADVDLIVGGISENPVHG------SIGPTFSCIISEQFVHVL 641

Human  1105 PE 1106
            .:
  Fly   642 KQ 643

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCN10AXP_005265428.1 Ion_trans 150..410 CDD:278921
Na_trans_cytopl 466..>537 CDD:288761 13/71 (18%)
Ion_trans 685..897 CDD:278921 49/276 (18%)
Na_trans_assoc 907..1150 CDD:284034 37/214 (17%)
Ion_trans 1172..1430 CDD:278921
Na_channel_gate 1422..1474 CDD:240441
Ion_trans 1496..1735 CDD:278921
GPHH 1745..1802 CDD:293510
IrcNP_001262653.1 An_peroxidase 151..672 CDD:281139 111/641 (17%)
An_peroxidase_like 290..637 CDD:265428 79/423 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.78878 Normalized mean entropy S3904
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.