DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCML1 and Scm

DIOPT Version :10

Sequence 1:XP_005274635.1 Gene:SCML1 / 6322 HGNCID:10580 Length:330 Species:Homo sapiens
Sequence 2:NP_731385.1 Gene:Scm / 41168 FlyBaseID:FBgn0003334 Length:877 Species:Drosophila melanogaster


Alignment Length:162 Identity:51/162 - (31%)
Similarity:77/162 - (47%) Gaps:23/162 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   183 VHPSDFSEHNCQPYYAS------------------DGATYGSSSGLCLGNPRADSIHNTYSTDHA 229
            |||...:......||.|                  .|....||:.|..|...|.......:...|
  Fly   708 VHPEQANVKPSNSYYKSPTTLSSSASLPTSVSTPFTGCQSASSTALAAGGVTAAKAATAPAGAAA 772

Human   230 SA-APPSVT--RSPVEN-DGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVDLFRSHEIDG 290
            :| |.||.|  .|||.. ...:....:...|..|::|.|:.:::..|. :|....||||.|||||
  Fly   773 TAGASPSYTAITSPVSTPTSALANSHLRSQPIDWTIEEVIQYIESNDN-SLAVHGDLFRKHEIDG 836

Human   291 KALLLLTSDVLLKHLGVKLGTAVKLCYYIDRL 322
            ||||||.|::::|::|:|||.|:|:|..::::
  Fly   837 KALLLLNSEMMMKYMGLKLGPALKICNLVNKV 868

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCML1XP_005274635.1 SAM_Scm 253..324 CDD:188977 30/70 (43%)
ScmNP_731385.1 zf-FCS 58..95 CDD:428958
MBT_dScm_rpt1 196..294 CDD:439097
MBT_dScm_rpt2 312..383 CDD:439100
SLED 418..522 CDD:463469
SAM_Scm 800..870 CDD:188977 30/70 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.