DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCML1 and phc1

DIOPT Version :9

Sequence 1:XP_005274635.1 Gene:SCML1 / 6322 HGNCID:10580 Length:330 Species:Homo sapiens
Sequence 2:XP_031761253.1 Gene:phc1 / 100488113 XenbaseID:XB-GENE-1013248 Length:852 Species:Xenopus tropicalis


Alignment Length:248 Identity:64/248 - (25%)
Similarity:100/248 - (40%) Gaps:92/248 - (37%)


- Green bases have known domain annotations that are detailed below.


Human    84 RRKVSKIQRFHARSLWTNHKRYGYKKHSYRLVK-KLKLQKMKKNEV--YETFSYPESYSPTLPVS 145
            |:|:.::|....    ...:|.|.:::|..:.: |::.::|:::..  .:..||.|::||     
 Frog   689 RKKLKELQEAGG----VRARRRGPRRNSSEIARAKIQGKRMREDSSRGSDNSSYDEAFSP----- 744

Human   146 RRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGA--TYGSSS 208
                    |.|.|..|                |||          |..:     ||:  |.|.|:
 Frog   745 --------NSPAPPSC----------------RTP----------HGDR-----DGSTPTGGPSN 770

Human   209 GLCLG-NPRADSIHNTYSTDHASAAPPSVTRSPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTD 272
            ...|| ||.                                  .::.:||.||||.|..|:..  
 Frog   771 SDLLGINPM----------------------------------FLSSNPSRWSVEEVYEFISS-- 799

Human   273 PLALC-PLVDLFRSHEIDGKALLLLTSDVLLKHLGVKLGTAVKLCYYIDRLKQ 324
             |..| .|.:.|||.||||:|||||..:.|:..|.:|||.|:|:|..|:.||:
 Frog   800 -LQGCQDLAEDFRSQEIDGQALLLLKEEHLMSALNIKLGPALKICAKINLLKE 851

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCML1XP_005274635.1 SAM_Scm 253..324 CDD:188977 33/71 (46%)
SAM 256..324 CDD:197735 33/68 (49%)
phc1XP_031761253.1 PHA03247 <381..631 CDD:223021
zf-FCS 645..677 CDD:399461
PHC2_SAM_assoc 678..783 CDD:406912 30/175 (17%)
SAM_Ph1,2,3 783..851 CDD:188976 33/70 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298184at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.