DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINB4 and Spn42Dd

DIOPT Version :9

Sequence 1:NP_002965.1 Gene:SERPINB4 / 6318 HGNCID:10570 Length:390 Species:Homo sapiens
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:381 Identity:142/381 - (37%)
Similarity:206/381 - (54%) Gaps:32/381 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    14 DLFQQFRKSKEN-NIFYSPISITSALGMVLLGAKDNTAQQISKVLHFDQVTENTTEKAATYHVDR 77
            :::|...||..| |:..||:||.:.|.||.:||:.:||:::...|...  :|:....||.|..  
  Fly    20 EIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLP--SEDKEAVAARYGA-- 80

Human    78 SGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYLDAIKKFYQTSVESTDFANAPEE 142
                      ||.:.....:...||:||:::....|...|.|..|:::.:::..||....|.| .
  Fly    81 ----------LLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGP-V 134

Human   143 SRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAIYFKGQWENKFKKENTKEEKFWPNKNTY 207
            :.::||.||..||:.|||.:...|::.:|...:||||||||||||:||....|:...|....|..
  Fly   135 AAERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKS 199

Human   208 KSVQMMRQYNSFNFALLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLT--AEKLMEWT 270
            ..||||.|..:|......|:.|:|:|:||...:|||.:.||.|::||..||||:.  |..|:   
  Fly   200 VPVQMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALEEKIVGFARPLV--- 261

Human   271 SLQNMRETCVDLHLPRFKMEESYDLKDTLRTMGMVNIFNGDADLSGM-TWSHGLSVSKVLHKAFV 334
                .:|  |.|.||:||:|...:||:||..:|:..:|...:||||: ....|..||:|.||||:
  Fly   262 ----AKE--VYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFL 320

Human   335 EVTEEGVEAAAATAVVVVELSSPSTNEEFCCNHPFLFFIRQNKTNSILFYGRFSSP 390
            ||.|||.|||.||:|.|...:..||  ....:|||.|.||.  .|:|.|.||..||
  Fly   321 EVNEEGAEAAGATSVAVTNRAGFST--FLMADHPFAFVIRD--ANTIYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINB4NP_002965.1 SERPIN 4..390 CDD:320777 140/379 (37%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 139/376 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 221 1.000 Domainoid score I2614
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 222 1.000 Inparanoid score I3541
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.