DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINB4 and nec

DIOPT Version :9

Sequence 1:NP_002965.1 Gene:SERPINB4 / 6318 HGNCID:10570 Length:390 Species:Homo sapiens
Sequence 2:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster


Alignment Length:384 Identity:112/384 - (29%)
Similarity:192/384 - (50%) Gaps:24/384 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    10 KFMFDLFQQFRKSK-ENNIFYSPISITSALGMVLLGAKD-NTAQQISKVLHFDQVTENTTEKAAT 72
            :|..:||::..||: :.|:.:||.|:.:.|.:: .||.| .|.:::.|...|.:           
  Fly   109 RFSSELFKEIIKSQSQQNVVFSPFSVHALLALI-YGASDGKTFRELQKAGEFSK----------- 161

Human    73 YHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYLDAIKKFY-QTSVESTDF 136
                .:..|...|:.:: ::.|..:..:|.:|.|::..:....:....|...||| ....|:.|.
  Fly   162 ----NAMAVAQDFESVI-KYKKHLEGADLTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEAVDM 221

Human   137 ANAPEESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAIYFKGQWENKFKKENTKEEKFW 201
            .|| :::..|||:||...|..||::|.....:...|..:||||:||:|:||::|...:|....|.
  Fly   222 QNA-KDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQ 285

Human   202 PNKNTYKSVQMMRQYNSFNFALLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKL 266
            ........|.||...:.:..|.|.::.|..||:.||....||::|||||..||.|:.::|:..:.
  Fly   286 HTNGRISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLSRPEF 350

Human   267 MEWTSLQNMRETCVDLHLPRFKMEESYDLKDTLRTMGMVNIFNGDADLSGMTWSHGLSVSKVLHK 331
            ........:|...|.:.||:|:.|...|:.:.|:.:|:..:|..::.::.: ....:.|||:|.|
  Fly   351 DLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKL-MDQPVRVSKILQK 414

Human   332 AFVEVTEEGVEAAAATAVVVVELSSPSTNEEFCCNHPFLFFIRQNKTNSILFYGRFSSP 390
            |::.|.|.|.||:||:....|.||.|....||..|.||:|.:|  ...|:||.|....|
  Fly   415 AYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAVR--TPASVLFIGHVEYP 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINB4NP_002965.1 SERPIN 4..390 CDD:320777 111/382 (29%)
necNP_524851.1 SERPIN 108..468 CDD:238101 111/379 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.