DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINB3 and nec

DIOPT Version :9

Sequence 1:NP_008850.1 Gene:SERPINB3 / 6317 HGNCID:10569 Length:390 Species:Homo sapiens
Sequence 2:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster


Alignment Length:386 Identity:111/386 - (28%)
Similarity:194/386 - (50%) Gaps:28/386 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    10 KFMFDLFQQFRKSK-ENNIFYSPISITSALGMVLLGAKD-NTAQQIKKVLHFDQVTENTTGKAAT 72
            :|..:||::..||: :.|:.:||.|:.:.|.:: .||.| .|.::::|...|   ::|...    
  Fly   109 RFSSELFKEIIKSQSQQNVVFSPFSVHALLALI-YGASDGKTFRELQKAGEF---SKNAMA---- 165

Human    73 YHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFY-QTSVESVDF 136
                    |...|:.:: ::.|..:..:|.:|.|::..:....:....|...||| ....|:||.
  Fly   166 --------VAQDFESVI-KYKKHLEGADLTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEAVDM 221

Human   137 ANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFW 201
            .|| :::..|||:||...|..||::|:...::...|..:||||:||:|:||.:|...||....|.
  Fly   222 QNA-KDTAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQ 285

Human   202 PNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKL 266
            ........:.||.....:..|.|.::.|..||:.||....||::|||||..||.|:.::|:..:.
  Fly   286 HTNGRISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLSRPEF 350

Human   267 MEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHK 331
            ........:|...|.:.||:|:.|...|:.:.|:.:|:..:|..::.::.:. .:.:.:|.:|.|
  Fly   351 DLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLM-DQPVRVSKILQK 414

Human   332 AFVEVTEEGAEAAAAT--AVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP 390
            |::.|.|.|.||:||:  ..|.....|..|  ||..|.||:|.:|  ...|:||.|....|
  Fly   415 AYINVGEAGTEASAASYAKFVPLSLPPKPT--EFVANRPFVFAVR--TPASVLFIGHVEYP 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINB3NP_008850.1 serpinB3_B4_SCCA1_2 1..390 CDD:381030 110/384 (29%)
necNP_524851.1 SERPIN 108..468 CDD:238101 110/381 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.