DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINB3 and Spn88Eb

DIOPT Version :9

Sequence 1:NP_008850.1 Gene:SERPINB3 / 6317 HGNCID:10569 Length:390 Species:Homo sapiens
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:421 Identity:119/421 - (28%)
Similarity:203/421 - (48%) Gaps:58/421 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     1 MNSLSE---ANTKFMFDLFQQFRK-SKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHF-- 59
            :|..|:   ....|...|.:|.|: ....|:|:||.|..:||.:....:.:.|.:::.:.|:.  
  Fly    28 LNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGW 92

Human    60 ----DQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYL 120
                .||.                 |.:...:...||.......||..||::|.::|       :
  Fly    93 ALNKQQVL-----------------VSYTLAQRQDEFRWRQSPMELSSANRIFVDRT-------I 133

Human   121 DAIKKF----YQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIY 181
            :...||    |..:.| :||.|.||...|:||.|:..:|:.:|::::....|..:|.|||.||.|
  Fly   134 NVSNKFNTLLYGATKE-LDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAY 197

Human   182 FKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIP----YKGK--- 239
            .||||..:|..|:|..:.|:.|:...:.:.||.:..:|.....|.:|::::::|    ||.|   
  Fly   198 MKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETH 262

Human   240 --------DLSMIVLLPNEID-GLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDL 295
                    |:|||::|||... .|.::..:|.|:.:.:|  .:.....:::|.||:|:.|:..:|
  Fly   263 ISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKW--FERALPQKIELSLPKFQFEQRLEL 325

Human   296 KDTLRTMGMVDIFNGDADLSGMTGSR-GLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTST 359
            ...|..||:..:|..:|....:|... .||:....|.|.::|.|.|:.|||||.::...||....
  Fly   326 TPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPD 390

Human   360 NEEFHCNHPFLFFIRQNKTNSILFYGRFSSP 390
            ..:|:|||||:|.|...|.::|||.|.:|.|
  Fly   391 PTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINB3NP_008850.1 serpinB3_B4_SCCA1_2 1..390 CDD:381030 118/419 (28%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 115/407 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.