DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATXN1 and Atx-1

DIOPT Version :9

Sequence 1:NP_000323.2 Gene:ATXN1 / 6310 HGNCID:10548 Length:815 Species:Homo sapiens
Sequence 2:NP_572356.1 Gene:Atx-1 / 31624 FlyBaseID:FBgn0029907 Length:230 Species:Drosophila melanogaster


Alignment Length:154 Identity:59/154 - (38%)
Similarity:89/154 - (57%) Gaps:26/154 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   567 PPTLPP-----------------YFMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSST 614
            ||:|||                 .|.:||.|:||:|.:::|||::||||||||..|...::..:|
  Fly    20 PPSLPPPSQQHWSSNGFSDDSASCFRRGSYIELASGAMRRVEDIRTEDFIQSALRSQLFELREAT 84

Human   615 VERIEDSHSPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSKLSVG 679
            |.||:.|..|.:..:.|:...|.|::.::|...:|.||:||||:||.|:.:.||::|.|.:|.||
  Fly    85 VVRIDWSGCPSLVTLTFSYDTHHAKMDLQVQPGHPMFVYGQGWASCDPQLSLQLYELKCQQLQVG 149

Human   680 DVCISLTLKNLKNGSVKKGQPVDP 703
            |:|:||         |...||..|
  Fly   150 DICLSL---------VPNEQPAAP 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATXN1NP_000323.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64
polyglutamine repeat 197..225
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 329..355
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..424
ATXN-1_C 415..445 CDD:289324
Self-association. /evidence=ECO:0000269|PubMed:9097953 494..604 23/53 (43%)
Interaction with USP7. /evidence=ECO:0000269|PubMed:12093161 538..815 59/154 (38%)
RNA-binding. /evidence=ECO:0000269|PubMed:11136710 540..766 59/154 (38%)
AXH 573..688 CDD:197779 50/114 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 762..798
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:P54254 794..797
Atx-1NP_572356.1 AXH 43..158 CDD:197779 51/123 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144537
Domainoid 1 1.000 111 1.000 Domainoid score I6242
eggNOG 1 0.900 - - E1_KOG4053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4678
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002655
OrthoInspector 1 1.000 - - otm40942
orthoMCL 1 0.900 - - OOG6_109233
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3533
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.620

Return to query results.
Submit another query.