DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPK12 and rl

DIOPT Version :9

Sequence 1:NP_002960.2 Gene:MAPK12 / 6300 HGNCID:6874 Length:367 Species:Homo sapiens
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:357 Identity:151/357 - (42%)
Similarity:225/357 - (63%) Gaps:17/357 - (4%)


- Green bases have known domain annotations that are detailed below.


Human     5 PPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAK 69
            |.:.:...|.::    :||...|..|..:|.||||.|.||.|..|..:|||||: .||:.:.:.:
  Fly    20 PQSNAEVIRGQI----FEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKI-SPFEHQTYCQ 79

Human    70 RAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLV 134
            |..||:.:|...:|||:|.:.|:...| ::|...|.|:|...|.|||.||:|.::|..|.|.:.:
  Fly    80 RTLREITILTRFKHENIIDIRDILRVD-SIDQMRDVYIVQCLMETDLYKLLKTQRLSNDHICYFL 143

Human   135 YQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSE------MTGYVVTRWYRA 193
            ||:|:||:|||:|.::||||||.||.:|:.|:|||.||||||.||.|      :|.||.||||||
  Fly   144 YQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRA 208

Human   194 PEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEA 258
            ||::||...||:::||||||||:|||::.:.:|.|..:||||..|:.|.|:|..:.::.:.:::|
  Fly   209 PEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKA 273

Human   259 KNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQV 323
            :||::.||......:|.:..||..||::||.|||..:..:|:...|||||||.|..:|..|||..
  Fly   274 RNYLESLPFKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVA 338

Human   324 Q---KYDDSFDDVDRTLDEWKRVTYKEVLSFK 352
            :   :.:...||:.|  |..|.:.::|.|.||
  Fly   339 EVPFRINMENDDISR--DALKSLIFEETLKFK 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPK12NP_002960.2 STKc_p38gamma 11..353 CDD:143385 150/351 (43%)
TXY 183..185 1/1 (100%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 146/337 (43%)
S_TKc 38..326 CDD:214567 132/289 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.