DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SAG and Arr2

DIOPT Version :9

Sequence 1:NP_000532.2 Gene:SAG / 6295 HGNCID:10521 Length:405 Species:Homo sapiens
Sequence 2:NP_523976.1 Gene:Arr2 / 38993 FlyBaseID:FBgn0000121 Length:401 Species:Drosophila melanogaster


Alignment Length:404 Identity:164/404 - (40%)
Similarity:243/404 - (60%) Gaps:34/404 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    16 IFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIG 80
            :|||.:.:..||.|||.||:|||:....|||||::|:||.:|.:||:..|...:|||:|:.:|:|
  Fly     7 VFKKATPNGKVTFYLGRRDFIDHIDYCDPVDGVIVVEPDYLKNRKVFGQLATTYRYGREEDEVMG 71

Human    81 LTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGK 145
            :.|.::|...|.|:.|........|.:||.|::|||||.|||...||...|.||.||....|:||
  Fly    72 VKFSKELILCREQIVPMTNPNMEMTPMQEKLVRKLGSNAYPFTFHFPPNSPSSVTLQQEGDDNGK 136

Human   146 SCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQ-PRAEAAWQFFMSDKPLHL 209
            ..||::.::||..||   |:|:..|:|.|.|:|:|:|:|||..|.: |.:..:..|..|:..:.|
  Fly   137 PLGVEYTIRAFVGDS---EDDRQHKRSMVSLVIKKLQYAPLNRGQRLPSSLVSKGFTFSNGKISL 198

Human   210 AVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVP- 273
            .|:|::|||:|||....||.|:||::|:||.||.|:.|...:.:.::. :.|.||..|.:|..| 
  Fly   199 EVTLDREIYYHGEKTAATVQVSNNSKKSVKSIKCFIVQHTEITMVNAQ-FSKHVAQLETKEGCPI 262

Human   274 -PNSTLTKTLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDR-TVLGILVSYQIKVK 336
             |.:.||||..|:||.|||::|.||||||.:|.||.||||||:::||... ...||::||.:::|
  Fly   263 TPGANLTKTFYLIPLAANNKDRHGIALDGHLKDEDVNLASSTMVQEGKSTGDACGIVISYSVRIK 327

Human   337 LTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKES-------------------YQ--DANLVFE 380
            |. .|.||    .|:.|:|||:|:.|.|....|:.                   ||  |.|:|||
  Fly   328 LN-CGTLG----GEMQTDVPFKLLQPAPGTIEKKRSNAMKKMKSIEQHRNVKGYYQDDDDNIVFE 387

Human   381 EFARHNLKDAGEAE 394
            :||:..:.:...|:
  Fly   388 DFAKMRMNNVNMAD 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SAGNP_000532.2 Arrestin_N 26..184 CDD:278754 70/157 (45%)
Arrestin_C 203..364 CDD:214976 73/163 (45%)
Arr2NP_523976.1 Arrestin_N 17..172 CDD:278754 70/157 (45%)
Arrestin_C 192..350 CDD:214976 73/163 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3865
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52566
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.