DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RTN2 and RTN1

DIOPT Version :9

Sequence 1:NP_005610.1 Gene:RTN2 / 6253 HGNCID:10468 Length:545 Species:Homo sapiens
Sequence 2:NP_010519.3 Gene:RTN1 / 851819 SGDID:S000002641 Length:295 Species:Saccharomyces cerevisiae


Alignment Length:242 Identity:46/242 - (19%)
Similarity:92/242 - (38%) Gaps:73/242 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   347 DLLYWKDTRTSGVVFTGLMVSLLCLLHFSIVSVAAHLALLLLCGTISLRVYRKVLQAVHRGDGAN 411
            |||.|::...:|..|.|.:::||.|...::::....:|..:|..|.|:....|:.    .|.|  
Yeast    22 DLLLWRNPVQTGKYFGGSLLALLILKKVNLITFFLKVAYTILFTTGSIEFVSKLF----LGQG-- 80

Human   412 PFQAYLDVDLTLTR---EQTERLSHQITSRVVSAATQL----------------RHFFLVEDLVD 457
                      .:|:   ::...::..|...:..|..||                :|.|       
Yeast    81 ----------LITKYGPKECPNIAGFIKPHIDEALKQLPVFQAHIRKTVFAQVPKHTF------- 128

Human   458 SLKLALLFYILTFVGAIFNGLTLLILGVIGLFTIPLLYRQHQAQID------------------- 503
              |.|:..::|....:.|:..|::.:..|..||:|::|..::.:||                   
Yeast   129 --KTAVALFLLHKFFSWFSIWTIVFVADIFTFTLPVIYHSYKHEIDATVAQGVEISKQKTQEFSQ 191

Human   504 -------QYVGLVTNQLSHIKAKIRAKIPGTGALASAAAAVSGSKAK 543
                   .|:..|.::|..|...:::|   |..::|.|...:.|.:|
Yeast   192 MACEKTKPYLDKVESKLGPISNLVKSK---TAPVSSTAGPQTASTSK 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RTN2NP_005610.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..183
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 199..250
Reticulon 345..509 CDD:280592 37/206 (18%)
RTN1NP_010519.3 Reticulon 21..178 CDD:396837 36/180 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I3067
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 1 1.000 - - mtm10165
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2275
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.800

Return to query results.
Submit another query.