DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RTN2 and rtn2b

DIOPT Version :9

Sequence 1:NP_005610.1 Gene:RTN2 / 6253 HGNCID:10468 Length:545 Species:Homo sapiens
Sequence 2:NP_001025130.1 Gene:rtn2b / 562639 ZFINID:ZDB-GENE-060331-95 Length:208 Species:Danio rerio


Alignment Length:208 Identity:78/208 - (37%)
Similarity:123/208 - (59%) Gaps:5/208 - (2%)


- Green bases have known domain annotations that are detailed below.


Human   341 MGSKVADLLYWKDTRTSGVVFTGLMVSLLCLLHFSIVSVAAHLALLLLCGTISLRVYRKVLQAVH 405
            |.|||.||:||::..|:|||||||:|.|..|...|.:::.::|.|.::..|:.:|:..|.:....
Zfish     1 MASKVLDLIYWRNLATTGVVFTGLVVGLASLFQLSAITILSNLGLSIMAFTLPVRLLYKAMTVTR 65

Human   406 RGDGANPFQAYLDVDLTLTREQTERLSHQITSRVVSAATQLRHFFLVEDLVDSLKLALLFYILTF 470
            ..||::|||:|||.|.|||.|.|.|::.|:...:.:|.::|:..|.::.::||:|..:..|:||:
Zfish    66 LNDGSHPFQSYLDEDHTLTDEDTVRMAEQMVLLIATAVSELKRLFFIDSIMDSVKFIVFLYLLTY 130

Human   471 VGAIFNGLTLLILGVIGLFTIPLLYRQHQAQIDQYVGLVTNQLSHIKAKI-----RAKIPGTGAL 530
            ||...|||||::.|||..|::||||:..|.:||:.:..|...:..|...:     .||.|...|.
Zfish   131 VGVQANGLTLVMSGVICAFSLPLLYKLQQERIDKIIKAVQLLVEKITEMVDLVVSLAKPPPAPAP 195

Human   531 ASAAAAVSGSKAK 543
            ..|.|.....|.|
Zfish   196 PPAPALKHKQKTK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RTN2NP_005610.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..183
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 199..250
Reticulon 345..509 CDD:280592 65/163 (40%)
rtn2bNP_001025130.1 Reticulon 5..167 CDD:280592 65/161 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C194340644
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 1 1.500 - -
77.200

Return to query results.
Submit another query.