DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RTN2 and rtn1

DIOPT Version :9

Sequence 1:NP_005610.1 Gene:RTN2 / 6253 HGNCID:10468 Length:545 Species:Homo sapiens
Sequence 2:NP_001018789.2 Gene:rtn1 / 3361269 PomBaseID:SPBC31A8.01c Length:308 Species:Schizosaccharomyces pombe


Alignment Length:252 Identity:46/252 - (18%)
Similarity:86/252 - (34%) Gaps:47/252 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   294 ELSPPLWTAIGWVQRGPTPPTPVLRVLLKWAKSPRSSGVPSLSLGADMGSKVADLLYWKDTRTSG 358
            |.|.|:....| ...|.....|.|.....:..:.:.:..|.:|      :.:..:|.||:|..| 
pombe    83 ETSSPVCPVSG-AHGGADKKCPALEAGCPFTNTTKQNVDPEIS------NALWSVLTWKNTSCS- 139

Human   359 VVFTGLMVSLLCLLH------------------FSIVSVAAHLALLLLCGTISLRVYRKVLQAVH 405
              |:.|| |:|.|::                  |.|.|:.....|....|              .
pombe   140 --FSTLM-SILALVYVPSWINLPRLFFRTFRYVFLITSIIEFGGLFASNG--------------K 187

Human   406 RGDGANPFQAYLDVDLTLTREQTERLSHQITSRVVSAATQLRHFFLVEDLVDSLKLALLFYILTF 470
            ||..::...:|:..|    .:..:|:.:.|.........|.:.....|..:.:...::..:|..|
pombe   188 RGVLSHFRSSYITCD----SKALDRIVNSIVDIFNVMLIQFQRILFAESPILTFTASVAAFIEFF 248

Human   471 VGAIFNGLTLLILGVIGLFTIPLLYRQHQAQIDQYVGLVTNQLSHIKAKIRAKIPGT 527
            :....:..:|.:..|:..|.:|.||..::..|...|..:......:|.:....|..|
pombe   249 LSGFLSYKSLFVWNVLFAFILPRLYVCNERSIKHLVASLERSGDKLKKQATETINTT 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RTN2NP_005610.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..183
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 199..250
Reticulon 345..509 CDD:280592 34/181 (19%)
rtn1NP_001018789.2 Reticulon 130..285 CDD:280592 33/176 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.