DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2ab3 and His2A:CG33832

DIOPT Version :9

Sequence 1:NP_001268460.1 Gene:H2ab3 / 624957 MGIID:3644875 Length:115 Species:Mus musculus
Sequence 2:NP_001027331.1 Gene:His2A:CG33832 / 3772632 FlyBaseID:FBgn0053832 Length:124 Species:Drosophila melanogaster


Alignment Length:91 Identity:36/91 - (39%)
Similarity:57/91 - (62%) Gaps:1/91 - (1%)


- Green bases have known domain annotations that are detailed below.


Mouse    19 RSRTSRAELIFAVSLVEQHLREVSRARRLSDTVPIFLAAILESLTRRLLELAGNEAQRRGTERRI 83
            :||::||.|.|.|..:.:.||:.:.|.|:....|::|||::|.|...:|||||| |.|...:.||
  Fly    15 KSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGN-AARDNKKTRI 78

Mouse    84 TPELLDLAVYSNMELSDVFQFITISQ 109
            .|..|.||:.::.||:.:...:||:|
  Fly    79 IPRHLQLAIRNDEELNKLLSGVTIAQ 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2ab3NP_001268460.1 H2A 25..112 CDD:305064 33/85 (39%)
His2A:CG33832NP_001027331.1 PTZ00017 16..124 CDD:185399 36/90 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.